PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G05850.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 392aa    MW: 43624.4 Da    PI: 9.9146
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G05850.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.26.2e-072292681756
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      A+rsR RK+++i+eLe+kv++L++e  +   e+e l+++ 
  OMERI11G05850.2 229 AQRSRVRKLQYIAELERKVQALQSEGIDVSAEMEFLSQQN 268
                      89***********************988888888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-5218277IPR004827Basic-leucine zipper domain
CDDcd147033.80E-15219269No hitNo description
SuperFamilySSF579597.5E-6228271No hitNo description
Gene3DG3DSA:1.20.5.1704.8E-7229271No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MMMANAKLPK QALLPPRSPF PTAAGPYAGD HGPIARPQGA PHHRHGHGHG HGHHQRTSSE  60
SFIEEQPSWL DDLLNEPETP VRQHGRAGHR RSSSDSFALF DGGAAAGAYA NGFEGMGGGG  120
GQAAPWGGVQ EYYAKPSSFG RQQGRPWEQG MNNLVNYRQG GGPPMPAKEK VGGHHGSPSV  180
LRDHDHGMDR RSSDESGHDQ KVGPERKDGV PPKHAQSEAD TKRAKQQYAQ RSRVRKLQYI  240
AELERKVQAL QSEGIDVSAE MEFLSQQNIM LDLENKALKQ RLESLAQEQL IKRFQQEMFE  300
REIGRLRSLY QQQQQQQKQP QPTTTLSRSN SRDLDSQFAN LSLKHKDPNS GPLRTQSSSI  360
LVRDAISTKR YPWAATAERE PEGEKNKNLH VH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0722670.0AK072267.1 Oryza sativa Japonica Group cDNA clone:J023004I18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617316.10.0uncharacterized protein At4g06598
TrEMBLA0A0E0F3R40.0A0A0E0F3R4_9ORYZ; Uncharacterized protein
STRINGOPUNC11G06870.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.23e-64bZIP family protein