PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G00820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 322aa    MW: 35238.8 Da    PI: 7.5227
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G00820.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.3e-3162115255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  OMERI11G00820.1  62 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 115
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9258118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2958116IPR009057Homeodomain-like
SuperFamilySSF466893.4E-1559116IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2261117IPR006447Myb domain, plants
PfamPF002491.3E-863114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGSAGKEEEE EDGGGGGAPT AATANNYGSS TTSSTTEEEE SGESRRRSSS SSVRPYVRSK  60
NPRLRWTPEL HLSFVRAVDR LGGQDRATPK LVLQLMNVRG LSIGHVKSHL QMYRSKKIDE  120
SGQVIGGESW RSDDHLQMQG GGHGGQAYNL GHLSLPALHH RSITAGSGTI FQSRFGNSWS  180
PWRCHGSYWL PAGHHLLVGS KPYYPPAAEA EAPFRRSSAR YVARANTSNH PDFVQGSSSS  240
PDDNIMNHQR PVLKEMICSE GSNHQEGPLN LDLSLDICPR GEKRKREFSW RKHEEGHDHT  300
TIAIGGDQEA ESCATGLSLS LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-1863117458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411710.0AK241171.1 Oryza sativa Japonica Group cDNA, clone: J065117O05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617115.10.0probable transcription factor RL9 isoform X1
TrEMBLA0A0E0F1J40.0A0A0E0F1J4_9ORYZ; Uncharacterized protein
STRINGOMERI11G00790.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-38G2-like family protein