PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G00630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 173aa    MW: 18560.4 Da    PI: 9.8438
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G00630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.42.4e-3161114255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  OMERI11G00630.1  61 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 114
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2957115IPR009057Homeodomain-like
PROSITE profilePS5129411.9257117IPR017930Myb domain
SuperFamilySSF466891.06E-1558115IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-2360116IPR006447Myb domain, plants
PfamPF002494.4E-962113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGSAGKEEEE EDGGGGAPAA AANNYGSSTT SSTTEEEGSG ESRRRTSSSS SVRPYVRSKN  60
PRLRWTPELH LSFVRAVDRL GGQDRATPKL VLQLMNVRGL SIGHVKSHLQ MYRSKKIDES  120
GQVIGGESWR SDDHLQMQGG GHGGQAYNLG HLSLPALNHR SITAGSGTIF QSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1962114355Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1962114355Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1962114355Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1962114355Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411710.0AK241171.1 Oryza sativa Japonica Group cDNA, clone: J065117O05, full insert sequence.
GenBankGU0467890.0GU046789.1 Oryza sativa Japonica Group cultivar Dongjin-byeo myb-like DNA-binding domain-containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617115.11e-120probable transcription factor RL9 isoform X1
RefseqXP_025877530.11e-120probable transcription factor RL9 isoform X2
TrEMBLA0A0E0F1F31e-122A0A0E0F1F3_9ORYZ; Uncharacterized protein
STRINGORUFI11G00320.11e-119(Oryza rufipogon)
STRINGONIVA11G00030.11e-119(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.19e-40G2-like family protein