PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G13220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 329aa    MW: 36087.3 Da    PI: 5.0238
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G13220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.62.6e-4981301122
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv++yL+kkv+++k++l +vi++vd+y++ePwdL++  ++   e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+
  OMERI10G13220.1   8 VPPGFRFHPTDEELVSYYLRKKVASQKIDL-DVIRDVDLYRIEPWDLQEhcRIGYeEQSEWYFFSYKDRKYPTGTRTNRATMTGFWKATGRDKA 100
                      69****************************.9***************953533332566*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWv 122
                      v + + +l+g++ktLvfykgrap+g+ktdW+
  OMERI10G13220.1 101 VRE-RCRLIGMRKTLVFYKGRAPNGHKTDWI 130
                      **9.8899**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-514142IPR003441NAC domain
PROSITE profilePS5100547.7028163IPR003441NAC domain
PfamPF023656.0E-239130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVIMESCVPP GFRFHPTDEE LVSYYLRKKV ASQKIDLDVI RDVDLYRIEP WDLQEHCRIG  60
YEEQSEWYFF SYKDRKYPTG TRTNRATMTG FWKATGRDKA VRERCRLIGM RKTLVFYKGR  120
APNGHKTDWI EEGWVVCRAF KKRTMQPPRS SIGAWEASYS YHDPAVFVGG GEHFKQEAAA  180
ELDGVAAAAA AAAGANAFLR YSTGRLPELP QLESPPLPSQ GSQAASAVVD GEEDNADSSR  240
RPGGAAAAAV TTDWRAFDKF VASQLSPEEQ HTCRATDDDD MAALLLLDGG GQEDDAGRWL  300
GSAGLLSAVA ADATTDCGLG TSCVPGDIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-45514412170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340730.0JN634073.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 4 mRNA, complete cds.
GenBankAC1139480.0AC113948.5 Oryza sativa chromosome 10 BAC OSJNBb0038A07 genomic sequence, complete sequence.
GenBankAC0923890.0AC092389.4 Oryza sativa chromosome 10 BAC OSJNBa0053C23 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAK1063130.0AK106313.1 Oryza sativa Japonica Group cDNA clone:002-101-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613865.10.0PREDICTED: NAC domain-containing protein 105
SwissprotQ9SL411e-101NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0E0F0A00.0A0A0E0F0A0_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g38834.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.17e-90vascular related NAC-domain protein 1