PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G10050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 324aa    MW: 35662.1 Da    PI: 5.6091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G10050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.3e-50111391129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF P+deelv++yL++kv+++++    ++ +vd++  ePw+Lp+ +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ v++
  OMERI10G10050.1  11 LPPGFRFCPSDEELVCFYLRNKVANHRVAS-GTLVDVDLHAREPWELPEVAKLTAEEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDRIVHE 103
                      79*************************888.88***************87788899**********************************9999 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                        ++++vg++ktLvfy grap+g+kt+Wvmhe+rle
  OMERI10G10050.1 104 GtTRAVVGMRKTLVFYLGRAPNGQKTTWVMHEFRLE 139
                      766778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-598157IPR003441NAC domain
PROSITE profilePS5100557.4611157IPR003441NAC domain
PfamPF023656.0E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAGLREMEST LPPGFRFCPS DEELVCFYLR NKVANHRVAS GTLVDVDLHA REPWELPEVA  60
KLTAEEWYFF SFRDRKYATG SRTNRATKTG YWKATGKDRI VHEGTTRAVV GMRKTLVFYL  120
GRAPNGQKTT WVMHEFRLET PNSQPKEDWV LCRVFDKKKP STIEAEGGGS SGSDLFIPGA  180
TDGSIDPSSP TTMAPLLSSS PDPTVVDRFD HRSAAVPPLM VLMQGGGDQM ISGSGVHCSN  240
NDNSGGSNAL LNLTMLQYSF LEHRPTGDDM AVGAHFGTCQ GGNNDATMAL GMGFEEHGMG  300
EIIEMEPAWR QGGSNCVYRD ELYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-491015816166NO APICAL MERISTEM PROTEIN
1ut4_B6e-491015816166NO APICAL MERISTEM PROTEIN
1ut7_A6e-491015816166NO APICAL MERISTEM PROTEIN
1ut7_B6e-491015816166NO APICAL MERISTEM PROTEIN
3swm_A7e-491015819169NAC domain-containing protein 19
3swm_B7e-491015819169NAC domain-containing protein 19
3swm_C7e-491015819169NAC domain-containing protein 19
3swm_D7e-491015819169NAC domain-containing protein 19
3swp_A7e-491015819169NAC domain-containing protein 19
3swp_B7e-491015819169NAC domain-containing protein 19
3swp_C7e-491015819169NAC domain-containing protein 19
3swp_D7e-491015819169NAC domain-containing protein 19
4dul_A6e-491015816166NAC domain-containing protein 19
4dul_B6e-491015816166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2294850.0GQ229485.1 Oryza sativa Japonica Group NAM-domain transcription factor mRNA, complete cds.
GenBankCT8347010.0CT834701.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA115P09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613250.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotQ84TE62e-60NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0E0EYX00.0A0A0E0EYX0_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g33760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.16e-77NAC domain containing protein 74