PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G06620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 350aa    MW: 36480.7 Da    PI: 6.5094
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G06620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19103156356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe+ +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  OMERI10G06620.1 103 KKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 156
                      456899***********************************************9 PP

2HD-ZIP_I/II127.84.6e-41102193192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrls eqv++LE+sFe+ +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkd++aL+r++da ++en++L + +++L++e+ 
  OMERI10G06620.1 102 EKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIV 193
                      69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1981159IPR009057Homeodomain-like
SuperFamilySSF466891.11E-1992160IPR009057Homeodomain-like
PROSITE profilePS5007117.31398158IPR001356Homeobox domain
SMARTSM003891.8E-19101162IPR001356Homeobox domain
CDDcd000863.28E-17103159No hitNo description
PfamPF000461.2E-16103156IPR001356Homeobox domain
PRINTSPR000315.1E-6129138IPR000047Helix-turn-helix motif
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
PRINTSPR000315.1E-6138154IPR000047Helix-turn-helix motif
PfamPF021831.6E-9158197IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MRPAMASNGG AAGAMAPFFP PNFLLQMQQP LPLHHQHLQD HAHGHLLPPP PPSLSPFLPD  60
LAMDAPPPPM YEASGGDGGG GGAASEDEED GCGGGGGGGG GEKKRRLSVE QVRTLERSFE  120
SGNKLEPERK AQLARALGLQ PRQVAIWFQN RRARWKTKQL EKDFDALRRQ LDAARAENDA  180
LLSLNSKLHA EIVALKGGAA AAGGGGSSCR QEAASELINL NVKETEASCS NRSENSSEIN  240
LDISRPPPPP PPANESPVNH HRGGGGIPFY ASIGRGGVDI DQLLLRGGHS PSPAAVTTPP  300
PPKMELGITG NGGGADATAA GAGGFGGLLC GAVDEQPPFW PWADGHHHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377490.0CT837749.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA049M06, full insert sequence.
GenBankAK2877000.0AK287700.1 Oryza sativa Japonica Group cDNA, clone: J065130H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613423.11e-160PREDICTED: homeobox-leucine zipper protein HOX23
SwissprotQ94GL51e-159HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
SwissprotA2Z7341e-159HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
TrEMBLA0A0E0EXK20.0A0A0E0EXK2_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g26500.11e-160(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-46HD-ZIP family protein