PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G06290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 131aa    MW: 14670.7 Da    PI: 10.5208
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G06290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA77.23e-242581158
        CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                     dep+YVNaKQy++I++RRq+R+ + +e+k+ ++ rk++l+e+R+k+A+ R+Rg+gGrF
  OMERI10G06290.1 25 DEPIYVNAKQYHAIIRRRQRRKIVGSEDKV-AAIRKRILFEARQKQAKLRRRGKGGRF 81
                     79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.8E-182384IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115222.522484IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.9E-172681IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.7E-142749IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.7E-145881IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MNEHIPSKGM KCTPLLPLPT EHADDEPIYV NAKQYHAIIR RRQRRKIVGS EDKVAAIRKR  60
ILFEARQKQA KLRRRGKGGR FISIEHPLEL SMDDQISKNG GSASPSSSTV SENSSNVNGF  120
TGDELCSRQL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-142583260NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470050.0EU847005.1 Oryza sativa Japonica Group clone KCS241E10 CCAAT-binding transcription factor mRNA, complete cds.
GenBankHQ7314780.0HQ731478.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613426.14e-62nuclear transcription factor Y subunit A-3
TrEMBLA0A0E0EXG04e-92A0A0E0EXG0_9ORYZ; Uncharacterized protein
STRINGOMERI10G06020.12e-85(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174681010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.17e-17nuclear factor Y, subunit A3