PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G12480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ERF
Protein Properties Length: 241aa    MW: 25299.1 Da    PI: 5.6962
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G12480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP256.95.2e-1850102155
              AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                      + y+GVr++   grWv+e+r+p ++g  +r +lg++ tae Aa+a++aa+++l+g
  OMERI09G12480.1  50 PVYRGVRRRGGAGRWVCEVRVPGKRG--ARLWLGTYVTAEAAARAHDAAMLALRG 102
                      68*******************95544..*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008472.6E-1350102IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.102.4E-2851112IPR001471AP2/ERF domain
SuperFamilySSF541719.81E-1951112IPR016177DNA-binding domain
SMARTSM003802.3E-1951116IPR001471AP2/ERF domain
PROSITE profilePS5103221.81251110IPR001471AP2/ERF domain
PRINTSPR003674.4E-55263IPR001471AP2/ERF domain
PRINTSPR003674.4E-57692IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MDMAGHELNS SSLSSSSGAE SSSSSSSGRQ QQQYKKRPAG RTKFRETRHP VYRGVRRRGG  60
AGRWVCEVRV PGKRGARLWL GTYVTAEAAA RAHDAAMLAL RGGAACLNFQ DSAWLLAVPP  120
AAPSDLAGVR RAATEAVAGF LQRSKGAEAM DEATSSVSAP PPLPNHAGCS SGTPGPSSID  180
GTADTAAAAA LDMFELDFFG EMDYDTYYAS LAEGLLMEPP PPATALWDNG DEGADIALWS  240
Y
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription (By similarity). {ECO:0000250}.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0068591e-161AP006859.1 Oryza sativa Japonica Group genomic DNA, chromosome 9, fosmid clone:OSJNOa273B05.
GenBankAP0149651e-161AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-161CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611305.11e-110dehydration-responsive element-binding protein 1H
SwissprotA2Z3881e-111DRE1H_ORYSI; Dehydration-responsive element-binding protein 1H
SwissprotQ0J0901e-111DRE1H_ORYSJ; Dehydration-responsive element-binding protein 1H
TrEMBLA0A0E0ETZ01e-173A0A0E0ETZ0_9ORYZ; Uncharacterized protein
STRINGOMERI09G12550.11e-174(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19636261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25470.11e-24C-repeat/DRE binding factor 2