PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G12430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 375aa    MW: 37969.2 Da    PI: 4.8666
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G12430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP103.34.2e-32116204594
              TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                        r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    ++s ++aa+ +
  OMERI09G12430.1 116 PPRNRDRHVKVEGRGRRIRMPVNCAARIAQLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTESPSAAARGD 204
                      5799*********************************************************99999444.44444444433333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.0E-26119198IPR005333Transcription factor, TCP
PROSITE profilePS5136925.128119173IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASQLQGKGA EAAAAGERVA PGTNAAAFAG FGYPPIQSPV ALQEEEGPRD AAFAGYAPPI  60
RSPVVSRLQG EGEGEKREEA GVAADGSAFA AGMALVPKPE PVAVEFLRGL AVAKPPPRNR  120
DRHVKVEGRG RRIRMPVNCA ARIAQLTREL GHKSDGETIR WLMQQSEPAI VAATGTGTVP  180
AIATTVDGVL RIPTESPSAA ARGDEPAPKR RRKLQPTRAA AGGPVEALAT APPPAVYYPI  240
VADPLLQANG GGSISISSGL APTSSATAPA ATGGGGAIPF IAMPASSDGG KQAMSPATVW  300
MVPPSGAGAV NQPIQYWAFQ PNPDHANFAG ASNYSVGQNP GVQEASASDQ AASTGGGGGE  360
DDEYEGTTDS SSDEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207213PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061750.0AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.10.0transcription factor PCF2-like
SwissprotA2YXQ12e-83PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH62e-83PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A0E0ETY50.0A0A0E0ETY5_9ORYZ; Uncharacterized protein
STRINGOMERI09G12500.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-41TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]