PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G09650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 359aa    MW: 37676.9 Da    PI: 6.864
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G09650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.6e-18172226256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OMERI09G09650.1 172 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 226
                      788899***********************************************98 PP

2HD-ZIP_I/II127.17.5e-41172262192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  OMERI09G09650.1 172 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 262
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-18157222IPR009057Homeodomain-like
SuperFamilySSF466891.88E-18160229IPR009057Homeodomain-like
PROSITE profilePS5007117.07168228IPR001356Homeobox domain
SMARTSM003891.1E-15170232IPR001356Homeobox domain
PfamPF000462.4E-15172226IPR001356Homeobox domain
CDDcd000861.95E-16172229No hitNo description
PROSITE patternPS000270203226IPR017970Homeobox, conserved site
PfamPF021831.4E-10228262IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-24228271IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MELGLSLGEA MADAGRELVL GLGMGRREEA VVEAGRRDHE VRRELEFGSR SSRCGGSSPE  60
PTVRLTLLPM VPGLGLPWPP PPSESRHLEA STRGFDVNRP PSSGGGGGAE EEQDDAAGAA  120
LSSSPNNSAG SFPMDDFSGH GLGGNDVAPG GGGGGDRSCS RASDEDDGGS ARKKLRLSKE  180
QSAFLEESFK EHSTLNPKQK LALAKQLNLR PRQVEVWFQN RRARTKLKQT EVDCEYLKRC  240
CETLTEENRR LQKELAELRA LKTVHPFYMH LPATTLSMCP SCERVASNSA PATASSAATS  300
STAAPPAAPS SGGIAATSSS SAAAAAAPDH RPSSFAALFS SPRGFPLSVA PQAQPPTSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220228RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611029.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotQ67UE20.0HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A0E0EST10.0A0A0E0EST1_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g27450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-62homeobox from Arabidopsis thaliana