PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G05950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 366aa    MW: 38058 Da    PI: 5.1339
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G05950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.63.1e-36731721100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC++dC+la+yfpa+++++f n+h+lFG+s+++k+l+++p+e + dam++l++eA+ara+dPv Ga++v+ +l +q+e l ael
  OMERI09G05950.1  73 ACAACKYQRRKCNADCPLARYFPADEQRRFLNAHHLFGVSKIQKTLRDTPPELHADAMQALTFEANARANDPVGGAARVVVELCRQYEMLFAEL 166
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+++++
  OMERI09G05950.1 167 AAVQHH 172
                      ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.66772173IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-3373170IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MTASSSTTNS SSSVSTADTS SSNPPPQHAL HRQHIASSSA SSGGGGGAPL PPRAPPRVGV  60
GGGGGSGVGQ SQACAACKYQ RRKCNADCPL ARYFPADEQR RFLNAHHLFG VSKIQKTLRD  120
TPPELHADAM QALTFEANAR ANDPVGGAAR VVVELCRQYE MLFAELAAVQ HHLKLCRQQH  180
AAAAAANDPL VANVDPLADP AAEMLFAGAV VPNQNDDAMV DAFYADQQTA GDGDQEQYLV  240
KDEAQAAQPP PQQPYEYLNY GTAGDEGSSH AWYTGNGGDA DASPPMGLSD QLQQCQIGAV  300
APFDVKPELP ATMEHGGSVF VEQPEQKILP AAGSSSSAAA APAPAHCQLE LGCSSNAWKV  360
GTHVIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056750.0AP005675.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1001_G09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611163.10.0PREDICTED: LOB domain-containing protein 19, partial
TrEMBLA0A0E0ERF90.0A0A0E0ERF9_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g19950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP182931010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.17e-28LOB domain-containing protein 7