PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G03700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 250aa    MW: 27332.2 Da    PI: 8.8171
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G03700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-333387155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl
  OMERI09G03700.1 33 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 87
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-313088IPR009057Homeodomain-like
PROSITE profilePS5129411.7383090IPR017930Myb domain
TIGRFAMsTIGR015571.5E-243388IPR006447Myb domain, plants
SuperFamilySSF466891.97E-163389IPR009057Homeodomain-like
PfamPF002491.5E-83586IPR001005SANT/Myb domain
PfamPF143791.2E-21128173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MFPPGLIHHR PDGGEAGRAA GGGPSLVLTA DPKPRLRWTA DLHERFVDAV AQLGGPEKAT  60
PKTILRTMGV KGLTLFHLKS HLQKYRLGKQ SGKEASEQSK DASYLLDAQG GMSVSPRVST  120
QDVKENQEVK EALRAQMEMQ RRLHEQVEVQ KHVQIRMEAY QKYIDTLLEK ACKIVSEQLA  180
SSGFSISDND LPELSGGVMC GSADTLSSSI FHQLSVSPIN LHSPEGKPTP SGIEGQMILQ  240
KSPELKRKSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-193389157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-193389157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-193389157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-193389157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0693360.0AK069336.1 Oryza sativa Japonica Group cDNA clone:J023010K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611986.10.0protein PHR1-LIKE 2
SwissprotQ94A573e-70PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A0D3H4W80.0A0A0D3H4W8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0B1190.0A0A0E0B119_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0EQI60.0A0A0E0EQI6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IHN20.0A0A0E0IHN2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QPE10.0A0A0E0QPE1_ORYRU; Uncharacterized protein
TrEMBLB9G2Q60.0B9G2Q6_ORYSJ; Uncharacterized protein
STRINGOGLUM09G05270.10.0(Oryza glumipatula)
STRINGOMERI09G03370.10.0(Oryza meridionalis)
STRINGORUFI09G05100.10.0(Oryza rufipogon)
STRINGONIVA09G04720.10.0(Oryza nivara)
STRINGOBART09G04520.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-72G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]