PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G17690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 83aa    MW: 9301.46 Da    PI: 10.9357
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G17690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1361.5e-113572542
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42
                     +r rr++kNRe+A rsR+RK+a+++eLe++v  L a+ 
  OMERI08G17690.1 35 RRKRRAMKNRESAERSRARKQAYLQELEQEVRLLRAKK 72
                     799*******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502179.8413374IPR004827Basic-leucine zipper domain
PfamPF001701.1E-83571IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-83573No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-93572No hitNo description
PROSITE patternPS0003603853IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MERAAGTGSG GDDEELLLYR AEEQQQLGGG GGAERRKRRA MKNRESAERS RARKQAYLQE  60
LEQEVRLLRA KKRRPAPPVP PGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126161e-88CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649649.11e-24protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0E0ENR05e-49A0A0E0ENR0_9ORYZ; Uncharacterized protein
STRINGOMERI08G17480.18e-50(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151931719