PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G14760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 226aa    MW: 24651.5 Da    PI: 7.3783
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G14760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.21.5e-12116176363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e +r rr+ +NRe+ArrsR RK+ ++ eL + v+ L + N++L +el++    +a ++ e+
  OMERI08G14760.1 116 EERRRRRMVSNRESARRSRMRKQRQLSELWTQVEHLRGANRRLLDELNRALRGCADVRREN 176
                      67899*******************************************9888887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12114178IPR004827Basic-leucine zipper domain
PfamPF001706.2E-10115174IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783116179IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-9118190No hitNo description
SuperFamilySSF579599.14E-11118166No hitNo description
PROSITE patternPS000360121136IPR004827Basic-leucine zipper domain
CDDcd147024.05E-15123167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MYHHHGGHGE VASLHLLSPP NPPFFGAAAR HHHHHGLINM ALPPQAYFVP ATPPPFQEAT  60
AALAAGDDDD AAMAVFELER ILEEAAATGG GGNGSPSSGS DGCCYGMQGV APAAEEERRR  120
RRMVSNRESA RRSRMRKQRQ LSELWTQVEH LRGANRRLLD ELNRALRGCA DVRRENSRLR  180
DEKAELAGKL QLLLPRQPAP EKNTADDHSS CSSEPCKNST TTTAAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130137RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043760.0AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
GenBankAP0045570.0AP004557.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0028A08.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8315040.0CT831504.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA115A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649077.11e-109bZIP transcription factor RISBZ3-like
TrEMBLA0A0E0EMK31e-165A0A0E0EMK3_9ORYZ; Uncharacterized protein
STRINGOMERI08G14460.11e-165(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.11e-10basic leucine-zipper 43