PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G14350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 267aa    MW: 28826.9 Da    PI: 4.3818
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G14350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.93.9e-194194356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     k+++++ eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  OMERI08G14350.1 41 KKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 94
                     456899***********************************************9 PP

2HD-ZIP_I/II134.44e-4340132193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrls eqv++LE+sFe+e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+ke
  OMERI08G14350.1  40 EKKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKE 132
                      69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.55E-193098IPR009057Homeodomain-like
PROSITE profilePS5007117.3943696IPR001356Homeobox domain
SMARTSM003891.6E-1839100IPR001356Homeobox domain
PfamPF000462.2E-164194IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1943103IPR009057Homeodomain-like
CDDcd000861.50E-164597No hitNo description
PRINTSPR000319.0E-66776IPR000047Helix-turn-helix motif
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PRINTSPR000319.0E-67692IPR000047Helix-turn-helix motif
PfamPF021837.3E-1896137IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MRSPAALLPV VADGGGVGVE EEMDVDEDMA MCGGRGGGGE KKRRLSVEQV RALERSFETE  60
NKLEPERKAR LARDLGLQPR QVAVWFQNRR ARWKTKQLER DYAALRQSYD ALRADHDALR  120
RDKDALLAEI KELKGKLGDE DAAASFSSVK EEEEEPAASD ADPPAAGAPQ GSSESDSSAV  180
LNDAEILPHK PAPAVAADAA ASETEAVVTG AALLHHAEVF FHGQLLKVDD DEAAFLGDDG  240
AACGGFFADE HLPSLPWWAE PTEQWTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13238GGRGGGG
26571ERKARLA
38896RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8294460.0CT829446.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA031N19, full insert sequence.
GenBankAK1068180.0AK106818.1 Oryza sativa Japonica Group cDNA clone:002-116-D05, full insert sequence.
GenBankAK0682440.0AK068244.1 Oryza sativa Japonica Group cDNA clone:J013140I04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650851.11e-160PREDICTED: homeobox-leucine zipper protein HOX20
SwissprotQ6Z2481e-162HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
SwissprotA2YWC01e-162HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
TrEMBLA0A0E0EMD80.0A0A0E0EMD8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA026788-PA1e-159(Oryza sativa Indica Group)
STRINGLOC_Os08g37580.11e-159(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-42homeobox protein 5