PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G14040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 385aa    MW: 40653.8 Da    PI: 7.804
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G14040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.31.9e-112272552856
                      HHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  28 eereeLAkklgLterqVkvWFqNrRakek 56 
                      +++  LAk+l+L  rqV vWFqNrRa+ k
  OMERI08G14040.1 227 KQKVALAKQLNLRPRQVEVWFQNRRARTK 255
                      68889**********************98 PP

2HD-ZIP_I/II94.41.2e-302252912592
      HD-ZIP_I/II  25 eperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      e+++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  OMERI08G14040.1 225 EQKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELR-ALK 291
                      689************************************************************9.565 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.325165257IPR001356Homeobox domain
SMARTSM003895.2E-5167261IPR001356Homeobox domain
CDDcd000861.55E-10169258No hitNo description
Gene3DG3DSA:1.10.10.601.9E-14169193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-14226260IPR009057Homeodomain-like
SuperFamilySSF466893.72E-10227266IPR009057Homeodomain-like
PfamPF000467.8E-9227255IPR001356Homeobox domain
PROSITE patternPS000270232255IPR017970Homeobox, conserved site
SMARTSM003403.5E-25257300IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-10257291IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MELGLSLGDA VTVADGGRPE LVLGLGVGVG AGARRGEEDE RGRREDVVGA GRWAAMAAAS  60
PEPSVRLSLV SSLGLHWPSE TARSEAAARG FDVNRAPSVA AGAPGMEDDE EGPGAAPALS  120
SSPNDSGGSF PLDLSGHGLR GHAEAAAQGG GGERSSSRAS DDDESASARK KLRLSKEQSA  180
FLEESFKEHS TLNPLLFFEY ARTRECLFLL ARSWPLTLML LTGGEQKQKV ALAKQLNLRP  240
RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ETLTEENRRL HKELAELRAL KTARPFYMHL  300
PATTLSMCPS CERVASNPAA ASTSAPAAAT SPAAAAAAPT AAARTAVASP EPHRPSSFAA  360
LFAAPRGFPL TAAQPRPPPP ASNCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249257RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411960.0AK241196.1 Oryza sativa Japonica Group cDNA, clone: J065121H01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648883.11e-173PREDICTED: homeobox-leucine zipper protein HOX27 isoform X2
SwissprotA2YW031e-176HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLA0A0E0EM960.0A0A0E0EM96_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g36220.11e-173(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-63homeobox from Arabidopsis thaliana