PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G13070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 292aa    MW: 31800.7 Da    PI: 6.4397
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G13070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like955.9e-302275255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +rlrWt +LHerFv av++LGG+++AtPk++l++m v+gLtl+h+kSHLQkYR 
  OMERI08G13070.1 22 TRLRWTGQLHERFVLAVAELGGADRATPKSVLRAMAVPGLTLYHLKSHLQKYRQ 75
                     7****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-292079IPR009057Homeodomain-like
SuperFamilySSF466894.3E-152078IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-212275IPR006447Myb domain, plants
PfamPF002491.3E-52374IPR001005SANT/Myb domain
PfamPF143793.2E-15136176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSSQQQQQHA GEAATAAAAA RTRLRWTGQL HERFVLAVAE LGGADRATPK SVLRAMAVPG  60
LTLYHLKSHL QKYRQVVSRS GNGGGGGLND RSSSSERQPD NHDGDSATDQ SHTTAYDGDS  120
DADAKEALRD SSRSMVQMQR EVQRKLQEQI EVQRHLQLRM EAQGRYLQSV LRRAQQVLAD  180
HSLASSPEAA TAELSELASA VDIECMSSSS SPPRRHRQSA ATDSCVTTTS SSEAESKAAG  240
SKRLHTSDCT VEQPVQGKRA FNFLQRHNQA DQEEEEYAGA EDGSSSEIDL NR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-172174154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-172174154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-172174154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-172174154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0703380.0AK070338.1 Oryza sativa Japonica Group cDNA clone:J023049D17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650853.11e-162myb-related protein 2
TrEMBLA0A0E0ELW70.0A0A0E0ELW7_9ORYZ; Uncharacterized protein
STRINGOMERI08G12790.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-43G2-like family protein