PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G10040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 180aa    MW: 20142.5 Da    PI: 8.6814
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G10040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.91.9e-173696363
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     +lkr rrk++NRe+A+rsR+RK++ ++ L+  v +L+ eN++L  +l++ ++ +a  +s++
  OMERI08G10040.1 36 DLKRKRRKESNRESAKRSRLRKQQHLDDLTSQVNQLKMENQQLTTTLNMVTQSCAFAESQN 96
                     79****************************************************9777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.3E-143191No hitNo description
SMARTSM003388.8E-173498IPR004827Basic-leucine zipper domain
PfamPF001705.6E-143695IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.2663688IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-123791No hitNo description
CDDcd147021.06E-213990No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MTLSGGTLSS GITSGSSHGT RSSGSEGDIQ LQVQMDLKRK RRKESNRESA KRSRLRKQQH  60
LDDLTSQVNQ LKMENQQLTT TLNMVTQSCA FAESQNSLLR TQMMELDSRL SVLREIIFYM  120
NNGNQSPSNP TIAATTYPST TTMTAATTGH YDYYDAFTAN AWGSGMQMMQ QPIDQFLYQC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13742KRKRRK
23843RKRRKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1005801e-176AK100580.1 Oryza sativa Japonica Group cDNA clone:J023105M12, full insert sequence.
GenBankAP0055201e-176AP005520.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0426E02.
GenBankAP0149641e-176AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126161e-176CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651067.11e-130bZIP transcription factor 44
TrEMBLA0A0E0EKQ11e-131A0A0E0EKQ1_9ORYZ; Uncharacterized protein
STRINGORGLA08G0106400.11e-130(Oryza glaberrima)
STRINGOBART08G12060.11e-130(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-14basic leucine-zipper 44