PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G08060.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 846aa    MW: 93118.4 Da    PI: 8.1055
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G08060.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.9e-20123178257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      r+ + +t +q e+L+++F+++++p++++ +eLAk+l++te+qVk+WFqNrR+++kk
  OMERI08G08060.3 123 RRYQLLTMQQKETLNRAFQSCPNPDRNDLKELAKELNMTETQVKYWFQNRRTQMKK 178
                      6677899***********************************************97 PP

2START1097.5e-353335608204
                      HHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
            START   8 qelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                      +e++ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ is+
  OMERI08G08060.3 333 NESLVKKKENGPLWLPHMdilgvESLNYQEYLAKSRTI-GqkpvdFKVVVTRDTAIVNGSCVDLVKSLLDAN-RWRELFPgivaSANTTKIIST 424
                      566667788999999888889999********999553.3589999**************************.******99999********** PP

                      T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE...-EESSEEEEEEEECTCEE CS
            START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepksnghs 162
                      g      g lqlm aelq++sp vp  d++f+R++ q g g w +vdvS+d   + ++         ss  +R   ++llpSg++ie+++ng+s
  OMERI08G08060.3 425 GpsnlhdGLLQLMRAELQVMSPEVPvCDVTFLRQSVQFGSGLWCVVDVSIDTVLPGESktaqssvqtSSTAARrmeVRLLPSGCVIEEMENGYS 518
                      ***************************************************9988887764322332222222344899*************** PP

                      EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      kvtw+ h+ +++r ++ l++sl++s  a ga +wva lqr+ 
  OMERI08G08060.3 519 KVTWMVHAAYDERAVPVLYHSLLRSAKALGACRWVASLQRHS 560
                      ****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-17109161IPR009057Homeodomain-like
SuperFamilySSF466891.55E-18111180IPR009057Homeodomain-like
PROSITE profilePS5007116.698119179IPR001356Homeobox domain
SMARTSM003894.4E-18121183IPR001356Homeobox domain
CDDcd000863.54E-19122178No hitNo description
PfamPF000467.2E-18123178IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-4162204IPR009057Homeodomain-like
PROSITE profilePS5084824.456308565IPR002913START domain
SuperFamilySSF559611.65E-19312560No hitNo description
CDDcd088754.49E-92312561No hitNo description
SMARTSM002343.3E-12317562IPR002913START domain
PfamPF018521.1E-27333560IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MAMAHMLGWA GPSLHASDHH CLRPRRRTPP PEPCPSLGRR GGDRGSPRSC AVLAIPLVEV  60
MDGELKLMAS YVSKLKFILQ KDQQQEPHTA NLLVLLGSSN QDKRNGLSQG ENRMDTCTRK  120
KPRRYQLLTM QQKETLNRAF QSCPNPDRND LKELAKELNM TETQVKYWFQ NRRTQMKKFK  180
NNEEHKLLQK ENEELKKENA ELRNRMMNST CRACDLPLFH IDCHHWENPM LKGENKGNHG  240
VTSNLIPQAV SSLLPSSSGF VASGSNLSSN AVLMPVSVMP SSVLQPAPAI SGANFPILHN  300
LSANANDGYT EKNVLLDLAN RAMEEFFSLI KENESLVKKK ENGPLWLPHM DILGVESLNY  360
QEYLAKSRTI GQKPVDFKVV VTRDTAIVNG SCVDLVKSLL DANRWRELFP GIVASANTTK  420
IISTGPSNLH DGLLQLMRAE LQVMSPEVPV CDVTFLRQSV QFGSGLWCVV DVSIDTVLPG  480
ESKTAQSSVQ TSSTAARRME VRLLPSGCVI EEMENGYSKV TWMVHAAYDE RAVPVLYHSL  540
LRSAKALGAC RWVASLQRHS QFLSGLHKYI FCPDSTKVVM RRKVLYLVKQ MTSSFTGLFA  600
SMSKATLQDG DDSHFAHQIV GSATGEPAGL LLSATTTIWL PSVNPRRVYD HLRDEQCHGE  660
WRCLLGEQLN QGNALPYGAP LNGETVPEFY RMVNGLHEGH AISLISPREM GGNISNTLLL  720
QEARTDLSGS LIVYARTDVN TVHSIMNSGL NPATVFLVSS GCAILPDCLE SFPLHPAATA  780
DQAGTSSAAI ASRSETGGSF VTVTYQMFFS SQGGAAPASS SIHQGHDALK KATDMFKVVL  840
DTLTVA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650917.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X2
TrEMBLA0A0E0EJW10.0A0A0E0EJW1_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.13e-94HD-ZIP family protein