PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G08060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 775aa    MW: 85691 Da    PI: 8.2794
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G08060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.6e-20123178257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      r+ + +t +q e+L+++F+++++p++++ +eLAk+l++te+qVk+WFqNrR+++kk
  OMERI08G08060.1 123 RRYQLLTMQQKETLNRAFQSCPNPDRNDLKELAKELNMTETQVKYWFQNRRTQMKK 178
                      6677899***********************************************97 PP

2START109.26.7e-352624898204
                      HHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
            START   8 qelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                      +e++ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ is+
  OMERI08G08060.1 262 NESLVKKKENGPLWLPHMdilgvESLNYQEYLAKSRTI-GqkpvdFKVVVTRDTAIVNGSCVDLVKSLLDAN-RWRELFPgivaSANTTKIIST 353
                      667777788999999888889999********999553.3589999**************************.******99999********** PP

                      T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE...-EESSEEEEEEEECTCEE CS
            START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepksnghs 162
                      g      g lqlm aelq++sp vp  d++f+R++ q g g w +vdvS+d   + ++         ss  +R   ++llpSg++ie+++ng+s
  OMERI08G08060.1 354 GpsnlhdGLLQLMRAELQVMSPEVPvCDVTFLRQSVQFGSGLWCVVDVSIDTVLPGESktaqssvqtSSTAARrmeVRLLPSGCVIEEMENGYS 447
                      ***************************************************9988887764322332222222344899*************** PP

                      EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      kvtw+ h+ +++r ++ l++sl++s  a ga +wva lqr+ 
  OMERI08G08060.1 448 KVTWMVHAAYDERAVPVLYHSLLRSAKALGACRWVASLQRHS 489
                      ****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-17109161IPR009057Homeodomain-like
SuperFamilySSF466891.39E-18111180IPR009057Homeodomain-like
PROSITE profilePS5007116.698119179IPR001356Homeobox domain
SMARTSM003894.4E-18121183IPR001356Homeobox domain
CDDcd000864.16E-19122178No hitNo description
PfamPF000466.5E-18123178IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-4162204IPR009057Homeodomain-like
SMARTSM002341.1E-12255491IPR002913START domain
CDDcd088751.17E-88263490No hitNo description
PfamPF018521.2E-27263489IPR002913START domain
SuperFamilySSF559612.06E-18300489No hitNo description
PROSITE profilePS5084821.786324494IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MAMAHMLGWA GPSLHASDHH CLRPRRRTPP PEPCPSLGRR GGDRGSPRSC AVLAIPLVEV  60
MDGELKLMAS YVSKLKFILQ KDQQQEPHTA NLLVLLGSSN QDKRNGLSQG ENRMDTCTRK  120
KPRRYQLLTM QQKETLNRAF QSCPNPDRND LKELAKELNM TETQVKYWFQ NRRTQMKKFK  180
NNEEHKLLQK ENEELKKENA ELRNRMMNST CRACDLPLFH IDCHHWENPM LKGENKGNHG  240
VTSNLIPQAV SSLLPSSSGF ENESLVKKKE NGPLWLPHMD ILGVESLNYQ EYLAKSRTIG  300
QKPVDFKVVV TRDTAIVNGS CVDLVKSLLD ANRWRELFPG IVASANTTKI ISTGPSNLHD  360
GLLQLMRAEL QVMSPEVPVC DVTFLRQSVQ FGSGLWCVVD VSIDTVLPGE SKTAQSSVQT  420
SSTAARRMEV RLLPSGCVIE EMENGYSKVT WMVHAAYDER AVPVLYHSLL RSAKALGACR  480
WVASLQRHSQ FLSGLHKYIF CPDSTKVVMR RKVLYLVKQM TSSFTGLFAS MSKATLQDGD  540
DSHFAHQIVG SATGEPAGLL LSATTTIWLP SVNPRRVYDH LRDEQCHGEW RCLLGEQLNQ  600
GNALPYGAPL NGETVPEFYR MVNGLHEGHA ISLISPREMG GNISNTLLLQ EARTDLSGSL  660
IVYARTDVNT VHSIMNSGLN PATVFLVSSG CAILPDCLES FPLHPAATAD QAGTSSAAIA  720
SRSETGGSFV TVTYQMFFSS QGGAAPASSS IHQGHDALKK ATDMFKVVLD TLTVA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650917.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X2
TrEMBLA0A0E0EJV90.0A0A0E0EJV9_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-88HD-ZIP family protein