PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G03690.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 207aa    MW: 21723.9 Da    PI: 5.4874
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G03690.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like513.3e-1641702655
          G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OMERI08G03690.3 41 GATPKSVLELMDVKDLTLAHVKSHLQMYRT 70
                     49***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-152971IPR009057Homeodomain-like
SuperFamilySSF466896.99E-64071IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-114170IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MELFPSQPDL SLQIGLPTGA AAAAHGHGLN ARFFAAAAGA GATPKSVLEL MDVKDLTLAH  60
VKSHLQMYRT VKNTERPAAS SDQADGFENG SAGEICDENS LDLHGGCRPE AMSAATAAAP  120
ARHGRLAACN DHGSSTGAHG ALWNSSSRED WSGFHESNTG SMQALKDMQS KSLEILSDMN  180
SCVSETTSST SELNLEFTLG RPQNRPN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126161e-100CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648943.11e-110probable transcription factor RL9 isoform X1
TrEMBLA0A0E0EI741e-150A0A0E0EI74_9ORYZ; Uncharacterized protein
STRINGOS08T0160300-001e-110(Oryza sativa)
STRINGOBART08G03630.11e-111(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.17e-22G2-like family protein