PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G03690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 350aa    MW: 36600.1 Da    PI: 7.4854
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G03690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-32160213255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OMERI08G03690.1 160 PRMRWTSTLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRT 213
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-16157214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-29158214IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-24160213IPR006447Myb domain, plants
PfamPF002495.7E-7161212IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MELFPSQPDL SLQIGLPTGA AAAAHGHGLN ARFFAAAAGA GGNNPAMASS PPSSLQLPLP  60
MPLPLPVPMA PAGGGLQFYP DAAAAAAMLR PIRGVPLYHH QQQQHAAAAP FVGAMPHHHP  120
SSGGACYCEP CHVAGAWRRG GCGGGGARGM VPAKRAPRAP RMRWTSTLHA RFVHAVELLG  180
GHDRATPKSV LELMDVKDLT LAHVKSHLQM YRTVKNTERP AASSDQADGF ENGSAGEICD  240
ENSLDLHGGC RPEAMSAATA AAPARHGRLA ACNDHGSSTG AHGALWNSSS REDWSGFHES  300
NTGSMQALKD MQSKSLEILS DMNSCVSETT SSTSELNLEF TLGRPQNRPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16161215357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16161215357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16161215357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16161215357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648943.11e-180probable transcription factor RL9 isoform X1
SwissprotQ0J2351e-42ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0E0EI720.0A0A0E0EI72_9ORYZ; Uncharacterized protein
STRINGOMERI08G03670.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47213665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-38G2-like family protein