PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G20490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 571aa    MW: 60480.1 Da    PI: 5.687
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G20490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.61.7e-15115175363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  OMERI07G20490.1 115 EAKRRARLVRNRESAHQSRQRKKQYVEELEGKVKVMQATIADLTARISCVTAENAALKQQL 175
                      78********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.0E-14113177IPR004827Basic-leucine zipper domain
PfamPF001707.8E-14115175IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415115175IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-17117175No hitNo description
SuperFamilySSF579591.0E-13117175No hitNo description
CDDcd147046.91E-22118169No hitNo description
PROSITE patternPS000360121135IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MAEPDLLAPF ADLPFPPPFP GDDLPDFPAL GDDAFALEDF DLEDLDFDFD VDLFPPDAPP  60
PVTTSSSSAA GSPEAGTSST GDGGSKNEES ADSSSPSRSG SDGGGGGGKD GKDDEAKRRA  120
RLVRNRESAH QSRQRKKQYV EELEGKVKVM QATIADLTAR ISCVTAENAA LKQQLGGAAG  180
AGAPPPPMPM YPAVYPLPMP WIHPAYAMRG SQVPLVPIPR LKTQQAASTP EPPAKKARKT  240
KKVAGVSLLG LLFLMMVCGC LVPAINRMYG AAYTGEGAAI VPSHHGRILA VEGPQNSVSN  300
GVDPKVPQNG SETLPALLYL PRNGKHVKIN GNLVIKSIVA SEKASSRLSN YGGKDSENQG  360
KEETSLAIPG YVAPLEAGEV MDSAKGMRNE LMALAPGDGS IYREDDGMLP QWFSEAMSGP  420
MLNSGMCTEV FQFDLSPTTA DANGIVPVYS GSVTNTSQNY TENLPSGPVQ KVKNRRISYS  480
EAIPLRGSTS NDTDHFKAPP KNHSQSHAGR KPVSSVVVSV LADPREASDR DGEGRISSNS  540
LSRIFVVVLI DSVKYVTYSC VLPFKSHSPH L
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000305|PubMed:22050533}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218980.0AK121898.1 Oryza sativa Japonica Group cDNA clone:J033105F09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647746.10.0bZIP transcription factor 60
SwissprotQ8LIB30.0BZP60_ORYSJ; bZIP transcription factor 60
TrEMBLA0A0E0EF600.0A0A0E0EF60_9ORYZ; Uncharacterized protein
STRINGOMERI07G20920.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.14e-73bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Oono Y, et al.
    Analysis of ER stress in developing rice endosperm accumulating beta-amyloid peptide.
    Plant Biotechnol. J., 2010. 8(6): p. 691-718
    [PMID:20331531]
  3. Hu J, et al.
    The Bphi008a gene interacts with the ethylene pathway and transcriptionally regulates MAPK genes in the response of rice to brown planthopper feeding.
    Plant Physiol., 2011. 156(2): p. 856-72
    [PMID:21487048]
  4. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  5. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  6. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]