PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G18960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 291aa    MW: 31188.8 Da    PI: 9.3469
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G18960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.31.5e-29133187358
        CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      p+YVNaKQ+++I++RR +Rak+e+e+++ +++rkpylheSRh+hA+rR+RgsgGrF
  OMERI07G18960.1 133 PIYVNAKQFNGIIRRRLARAKAEREHRV-SRGRKPYLHESRHRHAMRRARGSGGRF 187
                      9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-31129190IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.93130190IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.4E-30133187IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-22133155IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860135155IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-22164187IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEDTRILQNH HHQILAAGRQ LQQRHHFPAM PPERHHHPPP PAPGSPVMKF PIISGDSDLG  60
KDLKFHESSA PTIAAYSPLQ EYQGHFELAL GHSMVCTNFC NSDQSYGVYS PYGAQTMAGR  120
MLLPPAIATD VGPIYVNAKQ FNGIIRRRLA RAKAEREHRV SRGRKPYLHE SRHRHAMRRA  180
RGSGGRFLNT KNVSSSAAAA DAAPVSSGGG DHGASNKSSS ASEATRVYDD DDDMGAGGGG  240
GGGDFNHAMG HLHSPAFFPS LAAMMDGGGG GEGKWATATP HHGCRVDLLK V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A1e-18133189461HAPB protein
4g92_A1e-18133189461HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171180RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054540.0AP005454.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0455F03.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645550.11e-154nuclear transcription factor Y subunit A-2
TrEMBLA0A0E0EEK00.0A0A0E0EEK0_9ORYZ; Uncharacterized protein
STRINGOMERI07G19370.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP146632123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-25nuclear factor Y, subunit A10