PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G18140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 276aa    MW: 30066.2 Da    PI: 9.2811
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G18140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.41e-32123179158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  OMERI07G18140.1 123 EEPIFVNAKQYHAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 179
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-37121182IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.238122182IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-27124179IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-24125147IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860127147IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.6E-24156179IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MKQLGHKMYD QDSPSSDSGQ SHQEESAMND SSPNERHTST QSDNDDGPQM PDQDKTKSVS  60
SLGNPGALPP KLDYSQSFAC IPYAADAYYG GVLTGYSSHA IVHPQQNGTA NSRVPLPVEP  120
AAEEPIFVNA KQYHAILRRR QIRAKLEAQN KLVKGRKPYL HESRHRHAMK RARGSGGRFL  180
NTKQLEEQKQ QEEEAASGGA SSGNRTCLQN GTGSAPSTSA PSEIASVSSS REFLGNHEQS  240
HFPSAGILPT MSFRAQNGRD GKLVANAIHQ RVSMMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-23123184263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163172RHRHAMKRAR
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880330.0AB288033.1 Oryza sativa Japonica Group OsHAP2G mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1016840.0AK101684.1 Oryza sativa Japonica Group cDNA clone:J033058N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646559.10.0nuclear transcription factor Y subunit A-4
RefseqXP_015646560.10.0nuclear transcription factor Y subunit A-4
RefseqXP_015646561.10.0nuclear transcription factor Y subunit A-4
RefseqXP_015646562.10.0nuclear transcription factor Y subunit A-4
SwissprotQ9LNP62e-41NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A0E0EE650.0A0A0E0EE65_9ORYZ; Uncharacterized protein
STRINGOGLUM07G21630.10.0(Oryza glumipatula)
STRINGONIVA06G16650.10.0(Oryza nivara)
STRINGOBART07G21740.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-33nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  3. Djami-Tchatchou AT,Ntushelo K
    Expression Profile of Stress-responsive Arabidopsis thaliana miRNAs and their Target Genes in Response to Inoculation with Pectobacterium carotovorum subsp. carotovorum.
    Pak. J. Biol. Sci., 2017. 20(3): p. 147-153
    [PMID:29023006]