PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G16640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BES1
Protein Properties Length: 302aa    MW: 32191.1 Da    PI: 8.6003
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G16640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822221.71.6e-68101511145
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      +++gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gny+lpk++DnneVlkALcreAGwvvedDGttyrkg+kp+  ++a+g+s  +sp+ss+
  OMERI07G16640.1  10 AAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPP-PSSAGGASVGMSPCSST 102
                      589*************************************************************************.9999************* PP

           DUF822  95 q.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                      q +s+ ss+++spv+sy+asp+sssfpsps++d+ s+   ++llp+l+ l++
  OMERI07G16640.1 103 QlLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSA---SCLLPFLRGLPN 151
                      ********************************99866...588888876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.0E-6412136IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTSGAAAAAA AAGRTPTWKE RENNKRRERR RRAIAAKIFT GLRALGNYNL PKHCDNNEVL  60
KALCREAGWV VEDDGTTYRK GCKPPPSSAG GASVGMSPCS STQLLSAPSS SFPSPVPSYH  120
ASPASSSFPS PSRIDNPSAS CLLPFLRGLP NLPPLRVSSS APVTPPLSSP TASRPPKIRK  180
PDWDVDPFRH PFFAVSAPAS PTRGRRLEHP DTIPECDESD VSTVDSGRWI SFQMVTTAPT  240
SPTYNLVNPG ASASNSMEIE GTAGRGGAEF EFDKGRVTPW EGERIHEVAA EELELTLGVG  300
AK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067480.0AK106748.1 Oryza sativa Japonica Group cDNA clone:002-115-C06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645123.11e-177PREDICTED: protein BZR1 homolog 1
SwissprotQ7XI961e-179BZR1_ORYSJ; Protein BZR1 homolog 1
SwissprotB8B7S51e-179BZR1_ORYSI; Protein BZR1 homolog 1
TrEMBLA0A0E0EDL10.0A0A0E0EDL1_9ORYZ; Uncharacterized protein
STRINGORGLA07G0256600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-79BES1 family protein