PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G08100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 331aa    MW: 36204.9 Da    PI: 6.31
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G08100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.6e-5361331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd+++
  OMERI07G08100.1   6 LPPGFRFHPTDDELVGYYLKRKVDSLKIEL-EVIPVIDLYKFEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATSTGYWKATGKDRKI 98 
                      79****************************.99**************95334445667************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +  ge+ gl+ktLvfykgrap ge+tdWvmheyrl
  OMERI07G08100.1  99 AC-AGEVFGLRKTLVFYKGRAPGGERTDWVMHEYRL 133
                      **.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-613155IPR003441NAC domain
PROSITE profilePS5100557.8386156IPR003441NAC domain
PfamPF023654.6E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDS LKIELEVIPV IDLYKFEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATSTGYWK ATGKDRKIAC AGEVFGLRKT LVFYKGRAPG  120
GERTDWVMHE YRLCQDLAHG VSNFIGAYAL CRVIKRHEAG LHGEPPAAKA KGMISKVSSS  180
SSLVTVEHQL NGRGNALPSF TPTNNGSPLV DEMFVGGGGG GDPFQLLPSR IPYHGGDACG  240
FDLPPLCMPQ TQDPFFSDAG FTQAAPPFYG DAMGSVSEHE LKWDTLGGYS GGGGGGELWN  300
AAAAPLLCRQ ASDGDDLTAW FTAADDNMSV F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-53116012169NO APICAL MERISTEM PROTEIN
1ut4_B4e-53116012169NO APICAL MERISTEM PROTEIN
1ut7_A4e-53116012169NO APICAL MERISTEM PROTEIN
1ut7_B4e-53116012169NO APICAL MERISTEM PROTEIN
3swm_A5e-53116015172NAC domain-containing protein 19
3swm_B5e-53116015172NAC domain-containing protein 19
3swm_C5e-53116015172NAC domain-containing protein 19
3swm_D5e-53116015172NAC domain-containing protein 19
3swp_A5e-53116015172NAC domain-containing protein 19
3swp_B5e-53116015172NAC domain-containing protein 19
3swp_C5e-53116015172NAC domain-containing protein 19
3swp_D5e-53116015172NAC domain-containing protein 19
4dul_A4e-53116012169NAC domain-containing protein 19
4dul_B4e-53116012169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332470.0CT833247.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI241J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612876.10.0PREDICTED: transcription factor JUNGBRUNNEN 1
TrEMBLA0A0E0E9X50.0A0A0E0E9X5_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g42130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-84NAC domain containing protein 71