PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G06640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 352aa    MW: 37624.9 Da    PI: 4.3093
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G06640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.6e-2090143356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  OMERI07G06640.1  90 KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 143
                      56789************************************************9 PP

2HD-ZIP_I/II132.81.2e-4289180192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrl++eqv++LE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+d+++Lk+aydal++++++L +++++Lr+++ 
  OMERI07G06640.1  89 EKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHHALLSDNDRLRAQVI 180
                      69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.46E-1984147IPR009057Homeodomain-like
PROSITE profilePS5007118.23685145IPR001356Homeobox domain
SMARTSM003891.9E-1988149IPR001356Homeobox domain
CDDcd000865.17E-1990146No hitNo description
PfamPF000463.1E-1790143IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.1E-2191152IPR009057Homeodomain-like
PRINTSPR000316.6E-6116125IPR000047Helix-turn-helix motif
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PRINTSPR000316.6E-6125141IPR000047Helix-turn-helix motif
PfamPF021838.2E-17145187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDPGRVVFDS GVARRACPGG GGGGGGAQML LFGGGGSANS GGFFRGVPAA VLGMDETRSS  60
SSAAGAKRPF FTTHEELLEE EYYDEQAPEK KRRLTAEQVQ MLERSFEEEN KLEPERKTEL  120
ARRLGMAPRQ VAVWFQNRRA RWKTKQLEHD FDRLKAAYDA LAADHHALLS DNDRLRAQVI  180
SLTEKLQDKE TSPSSATITT AAQEVDQPDE HTEAASTTGF ATVDDALAAP PPGHQQPPHK  240
DDLLSSGGTI NDDGDGGGAA VVVFDVTEGA NDHLSCESAY FADAAEAYER DCAGHYALSS  300
EEEDGGAVSD EGCSFDLPDA AAAMFGAAGV VHHDAADDEE AQLGSWTAWF WS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457290.0AF145729.1 Oryza sativa homeodomain leucine zipper protein (Oshox5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650258.10.0PREDICTED: homeobox-leucine zipper protein HOX5
SwissprotQ6ZA740.0HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
SwissprotQ9XH360.0HOX5_ORYSI; Homeobox-leucine zipper protein HOX5
TrEMBLA0A0E0E9E90.0A0A0E0E9E9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA026973-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g32080.10.0(Oryza sativa Japonica Group)
STRINGLOC_Os08g32085.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-45homeobox 1