PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G06210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 282aa    MW: 31045.2 Da    PI: 5.4167
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G06210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.2e-51171421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv +yL+++++g + ++  +i+e+d+y+++PwdLp+++  +++ewyfF++rd+ky++g+r+nra++sgyWkatg dk+vl+
  OMERI07G06210.1  17 LPPGFRFHPTDEELVAHYLCPRAAGGPAPV-PIIAELDLYRHDPWDLPHRALFGRREWYFFTPRDRKYPNGSRPNRAAASGYWKATGADKPVLH 109
                      79*************************999.88***************87778999************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g++ g+kk Lvfy+g+ p g+kt+W+mheyrl
  OMERI07G06210.1 110 -NGRTAGIKKALVFYHGKPPCGVKTEWIMHEYRL 142
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6313173IPR003441NAC domain
PROSITE profilePS5100558.46817173IPR003441NAC domain
PfamPF023654.4E-2718142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAAAARRVRD AEADLNLPPG FRFHPTDEEL VAHYLCPRAA GGPAPVPIIA ELDLYRHDPW  60
DLPHRALFGR REWYFFTPRD RKYPNGSRPN RAAASGYWKA TGADKPVLHN GRTAGIKKAL  120
VFYHGKPPCG VKTEWIMHEY RLAKKGGAAA AAACAGAGAL RLDDWVLCRL YNKKNEWEKM  180
QSKKEEEDEA AAMAAAQSWG ETRTPESEVV DSDAFPEMDS LPAASLIDDA LLPKEEAHDD  240
DWLMGMSLDD LQGLGSLLQA DDLSMLAPPP PAKAEPLGAP FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-9161794174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0055160.0AP005516.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0066H10.
GenBankAP0045720.0AP004572.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0668C05.
GenBankAB0281820.0AB028182.1 Oryza sativa mRNA for OsNAC3 protein, complete cds.
GenBankAK0736670.0AK073667.1 Oryza sativa Japonica Group cDNA clone:J033052E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645028.11e-169PREDICTED: NAC domain-containing protein 67
SwissprotQ7EZT11e-171NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLA0A0E0E9690.0A0A0E0E969_9ORYZ; Uncharacterized protein
STRINGBGIOSGA025410-PA1e-168(Oryza sativa Indica Group)
STRINGLOC_Os07g12340.11e-168(Oryza sativa Japonica Group)
STRINGORGLA07G0064400.11e-168(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-69NAC domain containing protein 32