PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G03390.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 786aa    MW: 84410 Da    PI: 6.4489
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G03390.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25e-16470508240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  OMERI07G03390.2 470 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 508
                      589**********************************96 PP

2TCR50.93.1e-16556595140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  OMERI07G03390.2 556 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 595
                      589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17469510IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.33470596IPR005172CRC domain
PfamPF036388.9E-12472507IPR005172CRC domain
SMARTSM011141.7E-17556597IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-12558594IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MDTPDRAAAA PSAAARAEDS PLFSFIDSLS PIEPLKSAYS ASSIQAYQSL NITSISSIFT  60
SPHDNAQKES KLSKSSFAEF SESEVCADES DKNKPSKSSN AVRLFACTST LTQATHKITS  120
SVSEGTVGPP EGSNNLPPPG QFDSGSPDHN TTPCHGVRSD LKQGKCRKLQ AFQAAKTNTS  180
EKRKCLFSTE VQLMDGCQPE KLNDEILGCD WDDLISATSG ELIAYDEDHK GVQLAVSNAE  240
SCGFLLSKLT GDGDISDRTH PSSSTQTYYR ELLMDEDQTE NAQLVPDGEK NISTEEIQDN  300
LYEANGSIPT GYKVETQQQR GMRRRCLVFE AAGYSNRIVQ KESVMDLSVS TCKGKSPVQN  360
HSNPGKTPSP RVLRGIGLHL NALALTSKDK MVCQDPISSL VPSSATQQEA HGKMLSAGEN  420
FIHSGSELLE LQMDDDCSAG VFLGNDHDSS QSNSPQKKRR KADNGDDGEA CKRCSCKKSK  480
CLKLYCECFA AGVYCSEPCS CQGCLNKPIH EEIVLSTRKQ IEFRNPLAFA PKVIRMSDAG  540
QDITGEDPNN TPASARHKRG CNCKKSSCLK KYCECYQGGV GCSSNCRCEG CKNTFGKRDA  600
AVSTEAEEMK QGGEEAENCG KEKENDLQKA NVQSEDQPFL ELVPITPPFD VSSSLLKPPN  660
FSSAKPPRPT KARSNSSRSS SKAPGAVHSQ KFTKIANSGL NEEMPDILRD DASPGNCVKT  720
SSPNGKRVSP PHNALSVSPS QKGGRKLILK SIPSFPSLIG DASSGSSMNS SESAFNTASP  780
LALGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1647259312120Protein lin-54 homolog
5fd3_B1e-1647259312120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1456460KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646690.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A0E0E8390.0A0A0E0E839_9ORYZ; Uncharacterized protein
STRINGOMERI07G03420.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-84TESMIN/TSO1-like CXC 2