PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G27760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 150aa    MW: 16545.6 Da    PI: 6.5255
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G27760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.3e-1591139351
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      +++r++r+++NRe+A rsR+RK+a++eeLe++v  L   N  Lkk+ +e
  OMERI06G27760.1  91 DDRRTIRMMRNRESALRSRARKRAYVEELEKEVRRLVDDNLNLKKQCKE 139
                      589*************************************888877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-889149IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.42791136IPR004827Basic-leucine zipper domain
PfamPF001703.1E-1392139IPR004827Basic-leucine zipper domain
CDDcd147071.59E-1793139No hitNo description
SuperFamilySSF579591.63E-1193139No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-1393139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MANYHHQEYY QMAAAVAWPR EPDSPQLSIM SGCSSLFSIS TLRDDDDGVR LAGAALPATP  60
VSLAGIAGGA STPGGDEVDM EVRQQSGGSG DDRRTIRMMR NRESALRSRA RKRAYVEELE  120
KEVRRLVDDN LNLKKQCKEG SGMREDIVCR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8347450.0CT834745.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA103J07, full insert sequence.
GenBankCT8347470.0CT834747.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA126G01, full insert sequence.
GenBankCT8347480.0CT834748.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA223H09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642449.12e-91ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_015643092.12e-91ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_015643093.12e-91ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_015643094.12e-91ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_015643106.12e-91ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_015643107.12e-91ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
TrEMBLA0A0E0E6H81e-106A0A0E0E6H8_9ORYZ; Uncharacterized protein
STRINGOMERI06G26120.11e-96(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-06ABA-responsive element binding protein 3