PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G27590.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 1041aa    MW: 117740 Da    PI: 4.7743
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G27590.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.84.8e-08119164853
                      HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++ +
  OMERI06G27590.3 119 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNHS 164
                      55566***********************************998754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.5E-12110180No hitNo description
SMARTSM003381.6E-8110179IPR004827Basic-leucine zipper domain
PfamPF077164.9E-14114169IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.06E-7116163No hitNo description
CDDcd146865.01E-9124171No hitNo description
HamapMF_0050526.469306998IPR001404Heat shock protein Hsp90 family
Gene3DG3DSA:3.30.565.101.5E-91308519IPR003594Histidine kinase-like ATPase, C-terminal domain
PRINTSPR007752.4E-70309329IPR020575Heat shock protein Hsp90, N-terminal
SuperFamilySSF558741.96E-71309518IPR003594Histidine kinase-like ATPase, C-terminal domain
PROSITE patternPS002980329338IPR019805Heat shock protein Hsp90, conserved site
PRINTSPR007752.4E-70330352IPR020575Heat shock protein Hsp90, N-terminal
SMARTSM003874.8E-9331488IPR003594Histidine kinase-like ATPase, C-terminal domain
PfamPF025181.9E-14332487IPR003594Histidine kinase-like ATPase, C-terminal domain
CDDcd000755.92E-10335484No hitNo description
PRINTSPR007752.4E-70381398IPR020575Heat shock protein Hsp90, N-terminal
PRINTSPR007752.4E-70399416IPR020575Heat shock protein Hsp90, N-terminal
PRINTSPR007752.4E-70424446IPR020575Heat shock protein Hsp90, N-terminal
PRINTSPR007752.4E-70476493IPR020575Heat shock protein Hsp90, N-terminal
PfamPF001832.9E-2174901026IPR001404Heat shock protein Hsp90 family
PRINTSPR007752.4E-70494512IPR020575Heat shock protein Hsp90, N-terminal
SuperFamilySSF542111.9E-89576855IPR020568Ribosomal protein S5 domain 2-type fold
SuperFamilySSF1109423.53E-32874997No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006457Biological Processprotein folding
GO:0009306Biological Processprotein secretion
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009934Biological Processregulation of meristem structural organization
GO:0010075Biological Processregulation of meristem growth
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0005739Cellular Componentmitochondrion
GO:0005774Cellular Componentvacuolar membrane
GO:0005783Cellular Componentendoplasmic reticulum
GO:0005886Cellular Componentplasma membrane
GO:0009506Cellular Componentplasmodesma
GO:0009507Cellular Componentchloroplast
GO:0048046Cellular Componentapoplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005524Molecular FunctionATP binding
GO:0016887Molecular FunctionATPase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0051082Molecular Functionunfolded protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1041 aa     Download sequence    Send to blast
MAGLLTRRAA SCALHCQLPA AMDDGDLDFS NPDTFLCPAV GGADPDGSCS MDSYFDDILK  60
DTEHHACTHT HTCNPPVHDL SHTHTCVHVH TKIVSAPSDT PSDAAETAES PTENNASKKR  120
PSGNRAAVRK YREKKKAHTA SLEEEVVHLR ALNQQLMKKL QNHSTLEAEV SRLRCLLVDI  180
RGRIEGEIGA FPYQRPVKNI DLVSSVDQGS YLGGAQVMNS CDFRCADQMY CSPGMQVRTM  240
GEDGAVSGQV LGQAKKLQVN ADDSTDELVD PPKVEEKIGG VPHGLSTDSE VVQREAESIS  300
RKTLRSSAEK FEFQAEVSRL MDIIINSLYS NKDIFLRELI SNASDALDKI RFLALTDKEV  360
LGEGDTAKLE IQIKLDKEKK ILSIRDRGIG MTKEDLIKNL GTIAKSGTSA FVEKMQTGGD  420
LNLIGQFGVG FYSVYLVADY VEVISKHNDD KQHVWESKAD GSFAISEDTW NEPLGRGTEI  480
RLHLRDEAKE YVEEDKLKDL VKKYSEFINF PIYLWATKEV DVEVPADEDE SSESSEEEES  540
SPGSTEEEET EESEEKKPKT KTVKETTTEW ELLNDVKAIW LRSPKEVTEE EYTKFYHSLA  600
KDFGDDKPLS WSHFTAEGDV EFKALLFVPP KAPHDLYESY YNSNKSNLKL YVRRVFISDE  660
FDELLPKYLS FLKGLVDSDT LPLNVSREML QQHSSLKTIK KKLIRKALDM IRKLAEEDPD  720
EYSNKDKTDE EKSAMEEKKG QYAKFWNEFG KSVKLGIIED ATNRNRLAKL LRFESTKSEG  780
KLASLDEYIS RMKPGQKDIF YITGSSKEQL EKSPFLERLT KKNYEVIYFT DPVDEYLMQY  840
LMDYEDKKFQ NVSKEGLKLG KDSKLKDLKE SFKELTDWWK KALDTESVDS VKISNRLSDT  900
PCVVVTSKYG WSANMEKIMQ SQTLSDASKQ AYMRGKRVLE INPRHPIIKE LRDKVAQDSE  960
SESLKQTAKL VYQTALMESG FNLPDPKDFA SSIYRSVQKS LDLSPDAAVE EEEEVEEAEV  1020
EEKESSIKEE AEPSSYDKDE L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5uls_A0.0279100713690Endoplasmin
5uls_B0.0279100713690Endoplasmin
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay have a molecular chaperone role in the processing of secreted materials. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates rapidly in leaves upon heat shock treatment and during infection by a pathogen.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1203450.0GU120345.1 Oryza sativa Japonica Group clone KCB723G09 90 kDa heat shock protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642502.10.0endoplasmin homolog
SwissprotP361830.0ENPL_HORVU; Endoplasmin homolog
TrEMBLA0A0E0E6F40.0A0A0E0E6F4_9ORYZ; Uncharacterized protein
STRINGONIVA06G30100.10.0(Oryza nivara)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.13e-60bZIP family protein
Publications ? help Back to Top
  1. Walther-Larsen H,Brandt J,Collinge DB,Thordal-Christensen H
    A pathogen-induced gene of barley encodes a HSP90 homologue showing striking similarity to vertebrate forms resident in the endoplasmic reticulum.
    Plant Mol. Biol., 1993. 21(6): p. 1097-108
    [PMID:8490130]