PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G22690.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 267aa    MW: 27640 Da    PI: 9.0644
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G22690.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.74.4e-071662082163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++ e ++ v +L+ eN+ L++e+  l+  + +l +e+
  OMERI06G22690.5 166 RPRKKMRLPEIQQLVRSLTVENDGLREEMVALQRACTALSKEN 208
                      89***********************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-4166205No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MTAANAEACA VAAAADIICS LRGADLAGWT PPWGTAAAKG KEVVVEGEME EEELAWPTVA  60
RGKRSRSSRR RSPSGSGSAA TKGRWARGSP ASPLDYSGGS GSGSAASTSG GEDGAFCSPP  120
PPPPVVTAAA ATTPTAAPTP SPAKVGPAGR RQLILPTPTP RPAGQRPRKK MRLPEIQQLV  180
RSLTVENDGL REEMVALQRA CTALSKENCK LETRLEKSSK RNGTKSEGQQ ARPQPDEPAA  240
KQESQNGFVL PDLNLPVEDM AADGSAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165171RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644355.11e-111uncharacterized protein LOC4341662
TrEMBLA0A0E0E4D50.0A0A0E0E4D5_9ORYZ; Uncharacterized protein
STRINGONIVA06G26680.11e-112(Oryza nivara)