PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G02490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 266aa    MW: 28064.8 Da    PI: 8.6669
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G02490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-19102156256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k+q  +Lee+F+ +++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OMERI06G02490.1 102 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALAKSLNLRPRQVEVWFQNRRARTK 156
                      788899***********************************************98 PP

2HD-ZIP_I/II125.13.2e-40102192192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+++n+rL+ke +eLr +lk
  OMERI06G02490.1 102 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALAKSLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRWCDQLADDNRRLHKELAELR-ALK 192
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-1989159IPR009057Homeodomain-like
PROSITE profilePS5007116.66598158IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-18100161IPR009057Homeodomain-like
SMARTSM003892.8E-17100162IPR001356Homeobox domain
CDDcd000861.49E-15102159No hitNo description
PfamPF000467.3E-17102156IPR001356Homeobox domain
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
PfamPF021835.3E-11158192IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.3E-19158201IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MERQGLDLGL SLGLGLTTMA AAAATWPAAG FCLNSGMAEQ EVVRRDDVVV AAAEDERFAC  60
SPGSPVSSGS GKRTDRSGAG SGDEVDVDDA GCDVGGGGGG ARKKLRLSKD QAAVLEECFK  120
THHTLTPKQK VALAKSLNLR PRQVEVWFQN RRARTKLKQT EVDCEHLKRW CDQLADDNRR  180
LHKELAELRA LKATPTPPAA APPLTTLTMC LSCKRVANAG VPSPAAAMFP GHPQFLCGFR  240
DHAGAASSSS YDGASSGLAK AVRAAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8475160.0EU847516.1 Oryza sativa Japonica Group clone OsHD2B homeobox leucine zipper protein mRNA, complete cds.
GenBankAK0591160.0AK059116.1 Oryza sativa Japonica Group cDNA clone:001-022-E09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642539.11e-120PREDICTED: homeobox-leucine zipper protein HOX28
SwissprotA2Y9311e-122HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE51e-122HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLA0A0E0DWG90.0A0A0E0DWG9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA022270-PA1e-119(Oryza sativa Indica Group)
STRINGLOC_Os06g04850.11e-119(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-45homeobox from Arabidopsis thaliana