PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G00680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 350aa    MW: 38592.4 Da    PI: 10.4437
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G00680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32183236255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OMERI06G00680.1 183 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 236
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-15180237IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28181236IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23183237IPR006447Myb domain, plants
PfamPF002492.2E-7184235IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MMELFPRQLD LSLHISTPSC FSPSPASAST TASSWPWTKE KLPEEEEAAA TTSTTTSSRL  60
APPLLLYNSD VFSTTGSSAT NTNHHADGGL ANLQQQQQLK AAARQPIHGV PVYHGHQQQQ  120
RRQLHHPYDV MVGARQSDGG RRLFSHHMGV GVTPSRTLPS SSSSPPARLL PRLPPRRRSV  180
RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTIKNT  240
DRPVSNAGQN NDGFDNASAG DISDDSFTDG PLRQNKSMLA SEQNDTNIYS GLWSNNSSGK  300
VGLPIRKPAN EIYRRYLKNT KLSVDLETSM LRLPGRPNLE FTLGIGKASQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-16184238357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-16184238357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-16184238357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-16184238357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656560.11e-118PREDICTED: probable transcription factor KAN2
SwissprotQ9C6163e-48KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0E0DVQ40.0A0A0E0DVQ4_9ORYZ; Uncharacterized protein
STRINGOMERI06G00740.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174351111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.18e-42G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]