PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G20460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 648aa    MW: 70696.1 Da    PI: 5.6609
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G20460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.13.7e-1293155321217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p+ps++lgpkcalwdc rp++gs+++q+yc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaalsakvqgk+vgip+cegaat+kspwna+
  OMERI05G20460.1 315 PSPSQYLGPKCALWDCGRPVRGSDECQHYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALSAKVQGKNVGIPVCEGAATTKSPWNAP 408
                      89**************************************9799************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdlsllege++rewlffd+prraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eye+n++dalalyrle+
  OMERI05G20460.1 409 ELFDLSLLEGESLREWLFFDTPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYETNDSDALALYRLEY 502
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+k+s+k+k+++++l+++q++++rl+a
  OMERI05G20460.1 503 KSSDTKRSVKSKLASSPLSEIQQQMVRLSA 532
                      ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MAGDPAGGGG GGRGSSGGKG SSRSSSRHQQ FRNLAKTRVD DLQEMFSGLQ SARKESRSAD  60
AALLEEQVHH MLREWRAELN VPSPASSLQA IPPNPSFLLT CANSQSQGNN REASDPPSET  120
LRLLQLAGAE EEDDATSKLV MPRSPMPMQS SHEGHNLSPV LQGGAAELMV PRSPLQQMPS  180
SHQSHGHGQD GGQNLQGEAV MGSTAAAAPH LGQGMQGDCG GMAGVTNAMF HDQLYYIDHE  240
LNIDDFLQDD DYKINLPGSN PDGPNTMQGI GQLEHQQYNL PLDLPPNSFV DANNSAQSSG  300
DVFFHMSDLL TTMCPSPSQY LGPKCALWDC GRPVRGSDEC QHYCNPYHAG LALNDDGLLG  360
TRPVMRPRGI DLKDGPLFAA LSAKVQGKNV GIPVCEGAAT TKSPWNAPEL FDLSLLEGES  420
LREWLFFDTP RRAFDSGNRK QRSLPDYNGR GWHESRKQVM KDFGGLKRSY YMDPQPSSNY  480
EWHLFEYETN DSDALALYRL EYKSSDTKRS VKSKLASSPL SEIQQQMVRL SADSPVESKR  540
TARSRAKANQ KDNNSNAYPA LNTPVQVSAS NAHQTMSVNT PDQVNVSNAY QTMPLNTPNQ  600
PGPSNAYHAA SQMDQMTFLD GSVVYGPHLP YGYSTERSDF YWNPSDGT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640409.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-114VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0E0DTW30.0A0A0E0DTW3_9ORYZ; Uncharacterized protein
STRINGOMERI05G19650.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-111vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]