PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G19170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 320aa    MW: 36129.9 Da    PI: 9.1409
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G19170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.4e-102971446
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46
                      +  rr+++NReAAr+sR+RKka++++Le+   +L++  ++L+
  OMERI05G19170.1 29 AQTLRRLAQNREAARKSRLRKKAYVQQLEDSRMKLTQLEQELQ 71
                     56789************************99888888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.7E-62695IPR004827Basic-leucine zipper domain
PfamPF001701.4E-72871IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9562872IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-73273No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-83375No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
PfamPF141447.3E-31112187IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MPGFAAESAR RIRSARRTNF SRLLISAQAQ TLRRLAQNRE AARKSRLRKK AYVQQLEDSR  60
MKLTQLEQEL QRARQQGIII STSGDQQRST SENEALAFNM ECMRWLEEHN KQINELRSAV  120
HTHAGDDDLQ SIVSTVMAHH EEIFRIKGLA AKADALHVLS ATWRTPLERC FLWLGGFRPS  180
DLLKLLADQL EPLTEQQLAS IYNQQQSSQE AEETLSQGME MIQHSLAETV ASQLGRAGSS  240
SSPSNAADHT AAALGKIGDM ESLLQQADDL RMHNLHQMQR VLTTRQSARA LLLVSDYYSR  300
LRALNSLWIA HVHSNELKSI
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297181e-134AC129718.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0088I06, complete sequence.
GenBankAP0149611e-134AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881449.10.0transcription factor TGAL1-like isoform X1
SwissprotQ6IVC21e-141TGAL1_ORYSJ; Transcription factor TGAL1
TrEMBLA0A0E0DTE30.0A0A0E0DTE3_9ORYZ; Uncharacterized protein
STRINGOMERI05G18280.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169461111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06950.41e-117bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Chern M, et al.
    Interaction specificity and coexpression of rice NPR1 homologs 1 and 3 (NH1 and NH3), TGA transcription factors and Negative Regulator of Resistance (NRR) proteins.
    BMC Genomics, 2014. 15: p. 461
    [PMID:24919709]