PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G15500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 222aa    MW: 23539.4 Da    PI: 7.5467
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G15500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.34e-14141192354
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v+eLe+e  +L  e ee ++
  OMERI05G15500.1 141 AMQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQ 192
                      689**************************************99977666544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-9139204IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875141189IPR004827Basic-leucine zipper domain
PfamPF001703.9E-12141192IPR004827Basic-leucine zipper domain
CDDcd147071.74E-17143189No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-13144191No hitNo description
SuperFamilySSF579594.31E-11144190No hitNo description
PROSITE patternPS000360146161IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MNMDDILRNI YGEATPPAAA PAPAPAGEAA VAAGAGAPVA EVAARRTAEE VWKEISSSGG  60
LSAPTPAPTA GAAGRGGGPE MTLEDFLARE DDPRATAVEG NMVVGFPNGT EGVGTAGGGR  120
GGGGGGRGRK RTLMDPADRA AMQRQKRMIK NRESAARSRE RKQAYIAELE AQVAELEEEH  180
AQLLREQEEK NQKRLKEIKE QAVAVVIRKK TQDLRRTNSM EW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125GGRGGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8341090.0CT834109.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA060C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639395.11e-106PREDICTED: G-box-binding factor 4
TrEMBLA0A0E0DRX31e-156A0A0E0DRX3_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g36160.11e-106(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-13bZIP family protein