PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G14550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 421aa    MW: 45044.1 Da    PI: 6.797
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G14550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.94e-49411662128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  +
  OMERI05G14550.1  41 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGE 133
                      79***************************.89***************7777899**************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy+g+apkg++++W+m+eyrl
  OMERI05G14550.1 134 NSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 166
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-5740189IPR003441NAC domain
PROSITE profilePS5100554.81340189IPR003441NAC domain
PfamPF023651.8E-2442166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MSRDDVDDVT AGAAGSGEEA ADQEEAAAAV AGDSHENDLV MPGFRFHPTE EELIEFYLRR  60
KVEGRRFNVE LITFLDLYRF DPWELPAMAV IGEKEWFFYV PRDRKYRNGD RPNRVTASGY  120
WKATGADRMI RGENSRPIGL KKTLVFYSGK APKGVRSSWI MNEYRLPPPP ADTDLFYKSE  180
ISLCRVYKRS GIDDGHGHQR AAGNVQASSS AAARPPEHSG NTAGLPAGRH RPSPSSSSTT  240
TTQQHTSFHQ LLQGECSSAA AAPPSSSLPA SATTRNSNAS QLLMPPPPPR PPCAAAYTSS  300
SSAAAVVAPT ECAAVLAAAS TYSLLAAAGS SSTHIDELST LLAGHSHGGA YGNNHIVAGS  360
HHHFLPLPPL PPSPSQLMPQ LGTLPISPPL AAVSDKLWDW SSVPDTSTAR DYNSSGFSDP  420
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-554219019166NO APICAL MERISTEM PROTEIN
1ut4_B1e-554219019166NO APICAL MERISTEM PROTEIN
1ut7_A1e-554219019166NO APICAL MERISTEM PROTEIN
1ut7_B1e-554219019166NO APICAL MERISTEM PROTEIN
4dul_A1e-554219019166NAC domain-containing protein 19
4dul_B1e-554219019166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
GenBankAC1376230.0AC137623.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0426G01, complete sequence.
GenBankAC1349330.0AC134933.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0579A05, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637953.10.0PREDICTED: NAC domain-containing protein 48-like
TrEMBLA0A0E0DRG70.0A0A0E0DRG7_9ORYZ; Uncharacterized protein
STRINGORGLA05G0144900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.22e-96NAC domain containing protein 35