PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G06680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 319aa    MW: 31650.2 Da    PI: 7.2217
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G06680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.8e-3096149155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  OMERI05G06680.1  96 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 149
                      59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05993152IPR017930Myb domain
SuperFamilySSF466893.14E-2093153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-3095154IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-2497149IPR006447Myb domain, plants
PfamPF002491.3E-799148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MREEEEPSWF ARWEEQLPAP DELMPLSQSL ITPDLAVAFD IPTHGGGGGG GGGGGGGGGG  60
GVGAGEMNGG ASSAAGSSGG GGGGGGGDEP ARTLKRPRLV WTPQLHKRFV DAVAHLGIKN  120
AVPKTIMQLM SVDGLTRENV ASHLQKYRLY LKRMQGVGNG GGGGGGGGGG GAGGSHSSGS  180
GTDAATEHLF ATGPVPFLPP GRAPAGGDPY PPFAPMGAHH HHPPQIGHFH HHPAARPLGH  240
YGSGPGAGFD HGFLSRAVAG GGPPVGPPGM HHRMVGPAAG MAMMAPSPFA EELELGSRGG  300
GGGGGGRREL TLFPTTGDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A9e-3496152157Transcription factor LUX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1297306RGGGGGGGGR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1306070.0AC130607.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0017D10, complete sequence.
GenBankAC1307290.0AC130729.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0668F02, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640251.11e-149transcription factor MYBC1
SwissprotO222102e-55MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A0E0DNF50.0A0A0E0DNF5_9ORYZ; Uncharacterized protein
STRINGOMERI05G06420.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.17e-55G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]