PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G04500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 254aa    MW: 26239.6 Da    PI: 8.8061
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G04500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.2e-40651641100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+ael
  OMERI05G04500.1  65 PCAACKLLRRRCAQECPFSPYFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVQALEAEL 158
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++ 
  OMERI05G04500.1 159 AAVRAD 164
                      *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.22764165IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-4065162IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MSTASDWQDH HDQVGRKIKR ESSAADAADG RTTMMARRSC SMPAAAAAAG AGPGSAAAAV  60
NTITPCAACK LLRRRCAQEC PFSPYFSPLE PHKFASVHKV FGASNVSKML LEVHESQRGD  120
AANSLVYEAN LRLRDPVYGC MGAILTLQQQ VQALEAELAA VRADIVRHKY RLPSSAAAAA  180
VLPSSHASHL LAAAAAAGGG RGRHLPVAGT VGVVTTATLP ASASSSTTAV YAAAAASSST  240
DYSSITNENV PYFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1343411e-152AC134341.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0027N19, complete sequence.
GenBankAP0149611e-152AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638927.11e-133PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ9AT611e-68LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0E0DML50.0A0A0E0DML5_9ORYZ; Uncharacterized protein
STRINGORGLA05G0042200.11e-127(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.13e-58LOB domain-containing protein 13