PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G02170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 148aa    MW: 15924.9 Da    PI: 9.9973
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G02170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.7e-142483463
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+ +NRe+ArrsR+RK++++eeL  +++ L+aeN +   ++  +  e +k++ e+
  OMERI05G02170.1 24 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYAGELSKVDGEN 83
                     5678999**********************************9999999998888877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-182185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.32386IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-112378No hitNo description
SuperFamilySSF579591.19E-102577No hitNo description
PfamPF001707.8E-102579IPR004827Basic-leucine zipper domain
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSSPSRRSSS PESNTSGGGG GADERKRKRM LSNRESARRS RARKQQRLEE LIAEAARLQA  60
ENARVEAQIG AYAGELSKVD GENAVLRARH GELAGRLQAL GGVLEILQVA GAPVDIPEIP  120
DDPLLRPWQP PFAAQPIVAT AMADAFQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13744RRSRARKQ
Functional Description ? help Back to Top
Source Description
UniProtMay contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8418560.0CT841856.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C105C20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639544.11e-100ocs element-binding factor 1
SwissprotP240684e-34OCS1_MAIZE; Ocs element-binding factor 1
TrEMBLA0A0E0DLI61e-100A0A0E0DLI6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PH161e-100A0A0E0PH16_ORYRU; Uncharacterized protein
STRINGOMERI05G02150.11e-100(Oryza meridionalis)
STRINGORUFI05G02170.11e-100(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-24basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Singh K, et al.
    OCSBF-1, a maize ocs enhancer binding factor: isolation and expression during development.
    Plant Cell, 1990. 2(9): p. 891-903
    [PMID:2152133]