PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G01740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 89aa    MW: 9406.91 Da    PI: 8.8712
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G01740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.71.3e-213885148
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48
                     +CaaCk+lrr+C++ Cvlapyfp ++p+kf  +h++FGasn++kll+a
  OMERI05G01740.1 38 PCAACKILRRRCVDRCVLAPYFPPTEPHKFTTAHRVFGASNIIKLLQA 85
                     7*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.9743789IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-213885IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGSSSDTTCT VATAPPSPTP TSPPPQLAAT TTTVVLSPCA ACKILRRRCV DRCVLAPYFP  60
PTEPHKFTTA HRVFGASNII KLLQASSYC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126131e-144CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638880.12e-53PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK085e-29LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0E0DLC29e-58A0A0E0DLC2_9ORYZ; Uncharacterized protein
STRINGORGLA05G0016500.12e-38(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.15e-26LOB domain-containing protein 11