PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G24260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 494aa    MW: 54312.7 Da    PI: 8.0857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G24260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32311365155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  OMERI04G24260.1 311 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 365
                      68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.662308368IPR017930Myb domain
SuperFamilySSF466891.09E-17309365IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-30310366IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24311366IPR006447Myb domain, plants
PfamPF002499.6E-9315364IPR001005SANT/Myb domain
PfamPF143792.7E-22396442IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MAPYKTIELD KTKKIDVIVL TCADFLWHSV GPMKCKLFLW PVDDVGRRIK YVIALELETK  60
KNQISKENDS EDIMNTKKIK LHDCHFGSPL CDPSPSPHLL SSAAAAAAGL SFHPGLVSSA  120
AQHQQHGAGG WLHEEYYAPR SSPPSSLLAQ TCVGSNATAF YAAENLPQFD FPALGTAAAP  180
AAKAPFRSSE SDLYRPVDPL LLRADHSVRT YYVRPQKRDS GERTPLPPPS QQQRQDRIHG  240
LFAGAPTTRL LSGEPKIRSF SPQVAAKPIL PVMEAQNQMK NQLTRNCIGA ATPVTPTGNL  300
AGSAGAGAPS KTRIRWTQDL HERFVDCVNQ LGGADKATPK GILKLMNSDG LTIYHIKSHL  360
QKYRIAKYMP ASSEGKQLEK RATGNDMQNL DPKTGMQITE ALRVQLDVQR RLHEQLEIQR  420
NLQLRIEEQG KRLQKMFEDQ LKASRSVMEP QELDDVVAFA AGDGDDDAFD DVDVQLLAVA  480
GSGYDDAGFQ SKIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-23311368158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-23311368158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-23311368158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-23311368158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-23311368259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019510.0AK101951.1 Oryza sativa Japonica Group cDNA clone:J033075I07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636269.10.0uncharacterized protein LOC4337318 isoform X1
RefseqXP_015636270.10.0uncharacterized protein LOC4337318 isoform X1
RefseqXP_015636271.10.0uncharacterized protein LOC4337318 isoform X1
RefseqXP_015636272.10.0uncharacterized protein LOC4337318 isoform X1
RefseqXP_025880593.10.0uncharacterized protein LOC4337318 isoform X1
TrEMBLA0A0E0DJR10.0A0A0E0DJR1_9ORYZ; Uncharacterized protein
STRINGOMERI04G23830.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-66G2-like family protein