PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G22180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 397aa    MW: 45091 Da    PI: 5.9712
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G22180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.84.1e-12103143242
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                      +++k+ rr+++NReAAr+sR+RKka+i++Le+   +L +  
  OMERI04G22180.1 103 PPDKVLRRLAQNREAARKSRLRKKAYIQQLETSRLKLAQLE 143
                      5799***************************8544443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-11102166IPR004827Basic-leucine zipper domain
PfamPF001708.6E-9104144IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.933104148IPR004827Basic-leucine zipper domain
CDDcd147088.35E-21106155No hitNo description
SuperFamilySSF579595.47E-7106152No hitNo description
Gene3DG3DSA:1.20.5.1706.6E-8108156No hitNo description
PROSITE patternPS000360109124IPR004827Basic-leucine zipper domain
PfamPF141446.4E-26194270IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MELYPGYLED HFNIHKLSIS SASPPEYMTS ASTQFAAPVR MGAYDRPPPV GMWSHEQFKV  60
DNGQATSAST IMEAEMKFEN RLEEIPQVVL EEGRNVDQEA SKPPDKVLRR LAQNREAARK  120
SRLRKKAYIQ QLETSRLKLA QLEQELQRAR QQAVYANGSL REPNLGFTGP IDPGALGFEI  180
KYSHWVDEQN RNTGELRNAL LQGQTTDQNL ELKLLVEAGL DNYNRLFEMK EEAANSDVFY  240
IMSGMWKTPT ERFFLWIGGF RPSEVLKNLR PQLEPLTDKQ VVEVGGLQQT SMQVEDALSQ  300
GMDKLKQTIA DSLTAADPFD SPEAYMVHMA NAVEQLRSLV QFVTQADHLR QQTLQEMHRI  360
LTTRQAARGL LALGDYFQRF RALSSLWAAR PRDSGIS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0737150.0AK073715.1 Oryza sativa Japonica Group cDNA clone:J033059P06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636710.10.0transcription factor TGAL6 isoform X1
RefseqXP_015636711.10.0transcription factor TGAL6 isoform X1
RefseqXP_015636712.10.0transcription factor TGAL6 isoform X1
RefseqXP_025880677.10.0transcription factor TGAL6 isoform X1
SwissprotA0A0P0WFC80.0TGAL6_ORYSJ; Transcription factor TGAL6
TrEMBLA0A0E0DIW80.0A0A0E0DIW8_9ORYZ; Uncharacterized protein
STRINGOGLUM04G26680.10.0(Oryza glumipatula)
STRINGOS04T0637000-010.0(Oryza sativa)
STRINGONIVA03G13630.10.0(Oryza nivara)
STRINGOBART04G25140.20.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-122TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Okada A, et al.
    OsTGAP1, a bZIP transcription factor, coordinately regulates the inductive production of diterpenoid phytoalexins in rice.
    J. Biol. Chem., 2009. 284(39): p. 26510-8
    [PMID:19635799]
  3. Okada K
    The biosynthesis of isoprenoids and the mechanisms regulating it in plants.
    Biosci. Biotechnol. Biochem., 2011. 75(7): p. 1219-25
    [PMID:21737944]
  4. Yamane H
    Biosynthesis of phytoalexins and regulatory mechanisms of it in rice.
    Biosci. Biotechnol. Biochem., 2013. 77(6): p. 1141-8
    [PMID:23748776]
  5. Miyamoto K, et al.
    Identification of target genes of the bZIP transcription factor OsTGAP1, whose overexpression causes elicitor-induced hyperaccumulation of diterpenoid phytoalexins in rice cells.
    PLoS ONE, 2014. 9(8): p. e105823
    [PMID:25157897]
  6. Miyamoto K, et al.
    Overexpression of the bZIP transcription factor OsbZIP79 suppresses the production of diterpenoid phytoalexin in rice cells.
    J. Plant Physiol., 2015. 173: p. 19-27
    [PMID:25462074]