PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G19760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LFY
Protein Properties Length: 389aa    MW: 42530.3 Da    PI: 8.4779
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G19760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY544.14.8e-16613781386
          FLO_LFY   1 mdpea.fsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmks 92 
                      mdp++ fsa+  f+wd  +    +pa + +    ++          a+  releel+ +yGvr++tva+i+elGft+stL+ m+++eldd+m++
  OMERI04G19760.1   1 MDPNDaFSAAhPFRWDLGPP---APAPVPPPPPPPP------PPPPANVPRELEELVAGYGVRMSTVARISELGFTASTLLAMTERELDDMMAA 85 
                      777654776559****5322...2223322222222......234566789******************************************* PP

          FLO_LFY  93 lseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekk 186
                      l+ +fr+dll+Ger+G++aa+raer rl++     +++    +++ +++d +sqe+ls+e++     +agsgg+g  +++  +++ kk+ ++ +
  OMERI04G19760.1  86 LAGLFRWDLLLGERFGLRAALRAERGRLMSLG--GRHH---GHQSGSTVDGASQEVLSDEHD-----MAGSGGMGDDDNGRRMVTGKKQAKKGS 169
                      *****************************965..5555...6788889***********976.....678888888888887777766666666 PP

          FLO_LFY 187 kaskk.kqkrkkkkelkseededeeeeededeeg........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiak 271
                       a+k  k++rkk ++l+ + +ede +  ded+ g        +g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq++ak
  OMERI04G19760.1 170 AARKGkKARRKKVDDLRLDMQEDEMDCCDEDGGGgsestessAGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRLFLLQVQSMAK 263
                      555543667777777666644444443333333334455554888899********************************************** PP

          FLO_LFY 272 erGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprL 365
                       +G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeas+alrra+k+rgenvGawrqacy+plv+i+ar+g+didavf+ahprL
  OMERI04G19760.1 264 LHGHKSPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASDALRRAYKARGENVGAWRQACYAPLVDISARHGFDIDAVFAAHPRL 357
                      ********************************************************************************************** PP

          FLO_LFY 366 siWYvPtkLrqLChlerskas 386
                      +iWYvPt+LrqLCh++rs+++
  OMERI04G19760.1 358 AIWYVPTRLRQLCHQARSSHA 378
                      ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1911378IPR002910Floricaula/leafy protein
SuperFamilySSF1014474.18E-62737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP APAPVPPPPP PPPPPPPANV PRELEELVAG YGVRMSTVAR  60
ISELGFTAST LLAMTERELD DMMAALAGLF RWDLLLGERF GLRAALRAER GRLMSLGGRH  120
HGHQSGSTVD GASQEVLSDE HDMAGSGGMG DDDNGRRMVT GKKQAKKGSA ARKGKKARRK  180
KVDDLRLDMQ EDEMDCCDED GGGGSESTES SAGGGGGERQ REHPFVVTEP GEVARAKKNG  240
LDYLFHLYEQ CRLFLLQVQS MAKLHGHKSP TKVTNQVFRY AKKVGASYIN KPKMRHYVHC  300
YALHCLDEEA SDALRRAYKA RGENVGAWRQ ACYAPLVDIS ARHGFDIDAV FAAHPRLAIW  360
YVPTRLRQLC HQARSSHAAA AAALPPPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A7e-992163842170PROTEIN LEAFY
2vy2_A7e-992163842170PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0056200.0AB005620.1 Oryza sativa mRNA for RFL gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635355.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A0D9ZQ440.0A0A0D9ZQ44_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0DHU90.0A0A0E0DHU9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PDJ30.0A0A0E0PDJ3_ORYRU; Uncharacterized protein
STRINGOGLUM04G23830.10.0(Oryza glumipatula)
STRINGOMERI04G19020.10.0(Oryza meridionalis)
STRINGORUFI04G25610.10.0(Oryza rufipogon)
STRINGOS04T0598300-000.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-97floral meristem identity control protein LEAFY (LFY)