PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G19030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 624aa    MW: 65332.7 Da    PI: 7.2998
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G19030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS290.74e-892626242374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g++e a + La l+  a+++gd  qRl+a+++ AL++r+ +       + ++ +       e+ a  +l++++sP+++++ 
  OMERI04G19030.1 262 RQLLSEAAAAIADGHNETAATHLAALKRAANSRGDVEQRLVAMMVAALSSRIGQ-------TASVPDI---CGGETRAGSQLLHDISPCFRLAL 345
                      689**************************************************9.......1111122...24455566789************ PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +aN aI++av  ++++H +Dfd+s + Q + L++ La+R+ +  sl++T+v +p+s      + +l ++g+ L+k+Ae+ g++ +f++ v+ r
  OMERI04G19030.1 346 HAANVAIVDAVGDHRAIHLVDFDVSAP-QHADLIRCLAARRLPGTSLKVTAVTDPASPftqaLTATLPAVGDHLQKLAERAGIDYRFKM-VSCR 437
                      ************************987.99************************99888877788999********************9.7999 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                        ++e ++L ++ gEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe++ n++++ +rf++a+ +y a+++sl+a++pres
  OMERI04G19030.1 438 AGEIEASKLGCEAGEALAVNLAFALSHVPDESVSPANPRDEILRRVRALGPQVVALVEQELNSNTAPLTTRFTDACAHYGAILESLDATIPRES 531
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er+  E++ lg ++vn+va ega+r er+e ++kWr+r+++aGF+pv+l++ +a+q+ +    v+  g+ v+ e+g l lgW++r ++++SaW
  OMERI04G19030.1 532 AERARAEAA-LGGRAVNAVAREGADRLERCEVFGKWRARFGMAGFRPVALGTGIADQVLARQGPVA-AGFAVKAENGVLRLGWMGRVVTVASAW 623
                      ********9.99999******************************************977777777.99************************* PP

             GRAS 374 r 374
                      r
  OMERI04G19030.1 624 R 624
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.112235605IPR005202Transcription factor GRAS
PfamPF035141.4E-86262624IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYLYGVGS AVQMPMQQRS DAAAAGGVLK RSLGDMERWQ QHQQQQRQIA  60
MQQQLYLRTV RQRTAAASAA VSPLTSADIA AVLGGPPSQP PVLSGSSMGG AFGSPSSTLS  120
SITTASRAVT MPLMQPQLQR QQQVTYMASS PQVQGFGTAR ALPPAPATSD LSILQELEKQ  180
LLGDDDEVEA AMSGTGSAVT GSEWEEQLNS ITAAPSPPLT AATTPNNNNN AVGMTRSPSN  240
SSTSTASSSA SCSPPTSATT SRQLLSEAAA AIADGHNETA ATHLAALKRA ANSRGDVEQR  300
LVAMMVAALS SRIGQTASVP DICGGETRAG SQLLHDISPC FRLALHAANV AIVDAVGDHR  360
AIHLVDFDVS APQHADLIRC LAARRLPGTS LKVTAVTDPA SPFTQALTAT LPAVGDHLQK  420
LAERAGIDYR FKMVSCRAGE IEASKLGCEA GEALAVNLAF ALSHVPDESV SPANPRDEIL  480
RRVRALGPQV VALVEQELNS NTAPLTTRFT DACAHYGAIL ESLDATIPRE SAERARAEAA  540
LGGRAVNAVA REGADRLERC EVFGKWRARF GMAGFRPVAL GTGIADQVLA RQGPVAAGFA  600
VKAENGVLRL GWMGRVVTVA SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-352576241375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066880.0AL606688.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0064M23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637100.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0DHK40.0A0A0E0DHK4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014504-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g49110.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0197700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-95SCARECROW-like 8