Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G18610.2
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 817aa    MW: 87063.4 Da    PI: 5.897
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G18610.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
                      688999***********************************************998 PP

            START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                      la +a++elvk+a+ ++p+W   +        es+n +e+l +f++  +     + +ea+r+sg+v+ +  a lve+l+d  ++W+ ++     
                      67899***************9776778999****************9999**************998651568********************* PP

            START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksn 159
                      k +t+e is+g      gal lm+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpSg+++++++n
                      ************************************************************9987666666454555689*************** PP

            START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      g  kvtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
                      *********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.366119179IPR001356Homeobox domain
SMARTSM003893.2E-20120183IPR001356Homeobox domain
CDDcd000861.14E-20121177No hitNo description
PfamPF000467.6E-20122177IPR001356Homeobox domain
PRINTSPR000318.8E-5150159IPR000047Helix-turn-helix motif
PROSITE patternPS000270154177IPR017970Homeobox, conserved site
PRINTSPR000318.8E-5159175IPR000047Helix-turn-helix motif
PROSITE profilePS5084842.123323570IPR002913START domain
SuperFamilySSF559615.22E-23326567No hitNo description
CDDcd088755.52E-104327566No hitNo description
SMARTSM002341.4E-39332567IPR002913START domain
PfamPF018526.5E-42333567IPR002913START domain
SuperFamilySSF559615.63E-15587782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLA0A0E0DHD20.0A0A0E0DHD2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014527-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein