PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G18610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 829aa    MW: 88365.9 Da    PI: 5.9891
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G18610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.81.6e-22122177156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
  OMERI04G18610.1 122 KKRYHRHTPQQIQELEAMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQNRRTQMK 177
                      688999***********************************************998 PP

2START159.52.6e-503335672206
                      HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
            START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                      la +a++elvk+a+ ++p+W   +        es+n +e+l +f++  +     + +ea+r+sg+v+ +  a lve+l+d  ++W+ ++     
  OMERI04G18610.1 333 LAMSAMDELVKMAQMGDPLWIPGAsvpslpakESLNFEEYLNTFPPCIGvkpegYVSEASRESGIVIIDdGAALVETLMDEVRRWSDMFScmia 426
                      67899***************9776778999****************9999**************998651568********************* PP

                      EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECT CS
            START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksn 159
                      k +t+e is+g      gal lm+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpSg+++++++n
  OMERI04G18610.1 427 KTSTTEEISTGvagsrnGALLLMQAELQVLSPLVPiREVKFLRFSKQLADGVWAVVDVSADELMRDQGitsasSTANMNCRRLPSGCVLQDTPN 520
                      ************************************************************9987666666454555689*************** PP

                      CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      g  kvtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
  OMERI04G18610.1 521 GFVKVTWVEHTEYDEASVHPLYRPLLRSGLALGAGRWIATLQRQCEC 567
                      *********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24107179IPR009057Homeodomain-like
SuperFamilySSF466891.13E-21109177IPR009057Homeodomain-like
PROSITE profilePS5007118.366119179IPR001356Homeobox domain
SMARTSM003893.2E-20120183IPR001356Homeobox domain
CDDcd000861.17E-20121177No hitNo description
PfamPF000467.7E-20122177IPR001356Homeobox domain
PRINTSPR000319.0E-5150159IPR000047Helix-turn-helix motif
PROSITE patternPS000270154177IPR017970Homeobox, conserved site
PRINTSPR000319.0E-5159175IPR000047Helix-turn-helix motif
PROSITE profilePS5084842.123323570IPR002913START domain
SuperFamilySSF559615.36E-23326567No hitNo description
CDDcd088755.45E-104327566No hitNo description
SMARTSM002341.4E-39332567IPR002913START domain
PfamPF018526.6E-42333567IPR002913START domain
SuperFamilySSF559619.2E-15587794No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 829 aa     Download sequence    Send to blast
MSFGVGDHFG DGVVPAGMQF PYSSAGPGVF ASSPALSLAL ADAVAGRNSG GGGKMVTVAH  60
GGVGGGGGGH AKARDALEVE NEMSRSGSDH LDVVSCGDAG GGGGGGDDDD EDAEHGNPPK  120
RKKRYHRHTP QQIQELEAMF KECPHPDEKQ RAELSKRLGL EPRQVKFWFQ NRRTQMKMQL  180
ERHENALLKQ ENDKLRSENL SIREATSNAV CVGCGGPAIL GKVSLEEHHL RVENARLKDE  240
LSRVCTLAAK FLGKPISVMA PPQMHQPHPV PGSSLEFAVG GIGSMPSATI PISTITDFAG  300
AMSSSMGTVI TPMKSEAEPP AMAGIDKSLF LELAMSAMDE LVKMAQMGDP LWIPGASVPS  360
LPAKESLNFE EYLNTFPPCI GVKPEGYVSE ASRESGIVII DDGAALVETL MDEVRRWSDM  420
FSCMIAKTST TEEISTGVAG SRNGALLLMQ AELQVLSPLV PIREVKFLRF SKQLADGVWA  480
VVDVSADELM RDQGITSASS TANMNCRRLP SGCVLQDTPN GFVKVTWVEH TEYDEASVHP  540
LYRPLLRSGL ALGAGRWIAT LQRQCECLAL LMSSIALPEN DSSAIHPEGK RSMLKLARRM  600
TDNFCAGVST SSTHEWSKLV GLTGNIGEDV HVMARKSVDE PGTPPGVVLS AATSVWMPVM  660
SERLFNFLRN KGLRAEWDIL SNGGPMQEVT SIAKGQQNGN TSSVPLTKNF TVQPTKDKQN  720
SMLILQETCA DASGSMVVYA PVDIPAMHLV MSGGDSSCVA LLPSGFAILP AGPSIGADHK  780
MGGSLLTVAF QILANSQPSA KLTVESVETV SNLISCTIKK IKTALHCDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLA0A0E0DHD10.0A0A0E0DHD1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014527-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein