PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G32640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 389aa    MW: 40061.2 Da    PI: 6.9227
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G32640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32122175255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OMERI03G32640.1 122 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 175
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.35E-16119176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28120176IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23122175IPR006447Myb domain, plants
PfamPF002496.1E-8123174IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MLQRNLPNLS LRISPPAVSS AAAPVSSGVA TSAARTTLPT GVIITEAEGG GEVAAFFGNP  60
SSGSEPPGLS LGLGPATPAH ADAAAGRHGD HHLQPQGCAS FKRAAARASQ LPPGSKRSVR  120
APRMRWTTAL HARFVHAVEL LGGHERATPK SVLELMNVKD LTLAHVKSHL QMYRTVKSTD  180
RSSHIASGEA QLQQQAGMEV AMEAAAGGVG GGGGVVLPMM PACDDVVGIC SSPAAPAAAT  240
SSAAAYFLCA TTTSTATAPL AVVPSPPAPT IPTRRTDQTP VLEKGVAIVD SLHRCQKHNY  300
STVLQDALHQ GAEEDHLITG NLPMGGASAQ ASIEAMATTN SSSPASSSPS LASLEQMLPE  360
DSFAPNLEIS LGRQNWNMDH PEELSLKYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16123177357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16123177357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16123177357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16123177357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16123177458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084080.0AK108408.1 Oryza sativa Japonica Group cDNA clone:002-142-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629095.10.0transcription factor LUX
TrEMBLA0A0E0D7D60.0A0A0E0D7D6_9ORYZ; Uncharacterized protein
STRINGOGLUM03G35130.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65543750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.24e-39G2-like family protein